KEGG   Mus pahari (shrew mouse): 110330069
Entry
110330069         CDS       T05929                                 
Symbol
Ifngr2
Name
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04066  HIF-1 signaling pathway
mpah04217  Necroptosis
mpah04380  Osteoclast differentiation
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05164  Influenza A
mpah05168  Herpes simplex virus 1 infection
mpah05200  Pathways in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110330069 (Ifngr2)
   04066 HIF-1 signaling pathway
    110330069 (Ifngr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110330069 (Ifngr2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110330069 (Ifngr2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110330069 (Ifngr2)
   04658 Th1 and Th2 cell differentiation
    110330069 (Ifngr2)
   04659 Th17 cell differentiation
    110330069 (Ifngr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110330069 (Ifngr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110330069 (Ifngr2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110330069 (Ifngr2)
  09172 Infectious disease: viral
   05164 Influenza A
    110330069 (Ifngr2)
   05168 Herpes simplex virus 1 infection
    110330069 (Ifngr2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110330069 (Ifngr2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110330069 (Ifngr2)
   05140 Leishmaniasis
    110330069 (Ifngr2)
   05142 Chagas disease
    110330069 (Ifngr2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110330069 (Ifngr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110330069 (Ifngr2)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IFN receptor family
   110330069 (Ifngr2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 110330069
NCBI-ProteinID: XP_021065673
Ensembl: MGP_PahariEiJ_G0016666
LinkDB
Position
12:82593165..82608869
AA seq 330 aa
MRPLPLWLLSLLLCGLGAAASSPDSSSQLSAPQNPKLHLYNDEQTLTWEPSPSSDDTRPV
VYQVEYSYIDGSWYRLLRPNCTDITETKCDLTGGGRLKIFPHSFKVFLRVRAKRENLTSE
WVRLEPFQHYENVTVGPPKNISVTPGKGSLIIHFSPPFDVFHGATFQYLVHYWEKSGTRQ
VEGPFKSNSIVLGNLKPFRVYCLQTEAQLILKNKNIQPHGLLSNVSCHETTADASTRLQQ
VTLIPLGIFTLLLVLTGACFILFLKYQSRVKYWFQAPPNIPEQIKEYLKDPDQFILEALD
KDSSPKEDSWDSVSIISSPEKERDDVLHTP
NT seq 993 nt   +upstreamnt  +downstreamnt
atgcggcctctgccactgtggctgctgtcgctgctgctctgtgggctcggcgccgcggcg
tcctcgccagactcctcttcccagctctcggcccctcagaacccaaagcttcacctgtac
aatgacgagcagactctaacttgggagccgtcaccttccagcgatgacacgaggccagtg
gtctaccaggtggaatatagctacatcgatggctcttggtataggttgctgaggccgaac
tgtacggacatcacagagacgaagtgtgacctcacaggaggcggccgtttgaagattttc
ccacactcattcaaagtcttcctgcgggtgcgagccaagcgagaaaacctcacttccgag
tgggtgaggctggagccgtttcaacactatgagaatgttactgttggacctccgaaaaac
atctcggtgaccccaggaaaaggctccctcatcatacacttctcccctccttttgatgtg
ttccatggggcaacttttcagtatcttgtccactactgggaaaagtcaggaacccgacag
gttgaaggccctttcaagagcaattccattgtgctgggtaatctgaagccattcagagtg
tattgtttacaaactgaggcgcaactgattttgaaaaacaaaaatatccaaccacacggg
ctcttgagcaatgtatcctgtcatgaaacaacagcagatgcctccaccaggctgcagcaa
gtcaccctgattcctttgggcatcttcacattgctgctggtgctgacgggagcctgcttc
atcctgttcctcaaataccaaagccgggtgaagtactggtttcaagctccaccaaacatc
ccagaacaaatcaaagagtatctaaaggacccagatcaattcatcttggaggccttggac
aaggacagttcaccgaaggaggattcctgggactccgtgtcaatcatttcttctccagaa
aaggagcgagatgatgtgctccatacaccgtga

KEGG   Mus pahari (shrew mouse): 110338217
Entry
110338217         CDS       T05929                                 
Symbol
Ifngr1
Name
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04066  HIF-1 signaling pathway
mpah04217  Necroptosis
mpah04380  Osteoclast differentiation
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05164  Influenza A
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05200  Pathways in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110338217 (Ifngr1)
   04066 HIF-1 signaling pathway
    110338217 (Ifngr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110338217 (Ifngr1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110338217 (Ifngr1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110338217 (Ifngr1)
   04658 Th1 and Th2 cell differentiation
    110338217 (Ifngr1)
   04659 Th17 cell differentiation
    110338217 (Ifngr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110338217 (Ifngr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110338217 (Ifngr1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110338217 (Ifngr1)
  09172 Infectious disease: viral
   05164 Influenza A
    110338217 (Ifngr1)
   05168 Herpes simplex virus 1 infection
    110338217 (Ifngr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110338217 (Ifngr1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110338217 (Ifngr1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110338217 (Ifngr1)
   05140 Leishmaniasis
    110338217 (Ifngr1)
   05142 Chagas disease
    110338217 (Ifngr1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110338217 (Ifngr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110338217 (Ifngr1)
   04090 CD molecules [BR:mpah04090]
    110338217 (Ifngr1)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IFN receptor family
   110338217 (Ifngr1)
CD molecules [BR:mpah04090]
 Proteins
  110338217 (Ifngr1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind Comm P33MONOX
Other DBs
NCBI-GeneID: 110338217
NCBI-ProteinID: XP_021077151
Ensembl: MGP_PahariEiJ_G0023768
LinkDB
Position
21:43162751..43183490
AA seq 490 aa
MGPQAAAGRMILLVVLMLSAKAGSGAWASTEDPEPPSVPVPTNVLIKSYNLNPIVCWEYQ
NMSQTPVFTVQVKMYPDTWTDSCINISDQCCNIYEQIMYPDVSAWARVKAKVGQKESDYA
RSEEFLMCRKGKVGPPGLEIRRKEEQLTVLVFHPEVVVNEESQGTMFGDGSTCYTFDYTV
YVEHNRSGEILHTQHTVEKEDCNETLCELNISVSTLNSRYCVSVDGLSSFWQVRTEKSKD
VCIPLFHEDEKDSIWILVVAPLIVFTVVILVFACWYIKKNSFKRKSIMLPKSLLSVVISA
KSETKPESKYSLVIPCQPSVLENETVICEERLSTVTAPDSLEAAEQEELSKETKATAAGG
STSAMTPDSPPTPIQRGSFSLLSSNQSGPCSLTTYHSRNGSDSGLVGSGSSISDSEFLPN
NNSETKMAEHDPPPVRTAPTSSGYDKPHMLVDVLVDGGGKESLIGYRLTGDVQELSQGLP
SPAGGEGTDF
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgggcccgcaggcggcagctggcaggatgattctgctggtggtcctgatgctgtctgcg
aaggccgggagtggagcttgggcgagcacggaggatcctgagccgccctcggtgcctgtc
ccgacgaatgttctaattaagtcttataacttgaaccctatcgtatgctgggaataccag
aacatgtcacagactcctgtttttactgtacaggtaaagatgtacccggatacctggact
gattcctgcatcaacatttctgatcaatgttgtaacatctatgagcaaattatgtaccct
gatgtatctgcctgggccagagttaaagctaaggttggacaaaaagaatctgactatgca
cggtcagaagagttccttatgtgccgaaagggaaaggtcggaccccctggcctggagatc
aggaggaaggaagagcagctcactgtcctcgtatttcaccccgaggtcgttgtgaatgaa
gagagccagggaaccatgtttggtgacggaagcacctgttacacattcgactatactgtg
tatgtggagcataacaggagcggggagatcctacatacacagcatacggtcgaaaaagaa
gattgtaatgaaactctgtgtgagttaaacatctcagtatccacactgaattccagatac
tgtgtttcagtagatggactctcgtctttctggcaagttagaacagaaaaatcaaaagac
gtctgtatcccccttttccatgaggatgaaaaagattcaatctggattctggtcgttgct
cctcttatcgtctttacagtagttatcctggtatttgcatgttggtatattaagaagaat
tcattcaagagaaaaagcataatgttacccaagtccttgctctctgtggtcataagtgcc
aagtcggagacaaagcctgaatcaaagtattcacttgtcataccgtgccagccatctgtc
ctagagaatgagacggtgatctgtgaagagcgcttgtccacagtgacagctccagacagc
ctggaagcagcagaacaggaagaactctcaaaagaaacaaaggctactgctgctggagga
agcacttctgccatgaccccagacagccctccaactccgatacaaagaggcagcttttcc
ctgttaagtagtaaccagtcaggcccttgtagcctcaccacctatcactccagaaatggc
tctgacagtggtctcgtgggatcgggcagctccatatctgactcggaatttctcccaaac
aacaactcggaaacaaagatggcagagcacgaccctccgcccgtgagaacggcccccacg
tcctccggttatgataaaccgcacatgttggtggacgtgcttgtggatggtggggggaag
gagtccctgattgggtatagactcacaggagatgtccaggaactgtcccaaggtctcccg
agtcctgctggtggtgaaggaactgacttttaa

DBGET integrated database retrieval system