Mus pahari (shrew mouse): 110330924 Help Entry 110330924         CDS       T05929                                  Name (RefSeq) C-X-C motif chemokine 3   KO K05505   C-X-C motif chemokine 1/2/3 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04061   Viral protein interaction with cytokine and cytokine receptor mpah04062   Chemokine signaling pathway mpah04064   NF-kappa B signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04657   IL-17 signaling pathway mpah04668   TNF signaling pathway mpah04936   Alcoholic liver disease mpah05134   Legionellosis mpah05146   Amoebiasis mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05323   Rheumatoid arthritis mpah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     110330924    04668 TNF signaling pathway     110330924   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110330924    04061 Viral protein interaction with cytokine and cytokine receptor     110330924  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110330924    04657 IL-17 signaling pathway     110330924    04062 Chemokine signaling pathway     110330924  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     110330924   09171 Infectious disease: bacterial    05134 Legionellosis     110330924   09174 Infectious disease: parasitic    05146 Amoebiasis     110330924   09163 Immune disease    05323 Rheumatoid arthritis     110330924   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110330924   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110330924  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110330924 Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Chemokines    110330924 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  110330924 NCBI-ProteinID:  XP_021066893 Ensembl:  MGP_PahariEiJ_G0017173 LinkDB All DBs Position 13:79438542..79440511 Genome browser AA seq 99 aa AA seqDB search MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCHCLKTLPRVDFETIQSLTVRSPGP HCAQTEVIATLKSGQEVCLNPQGPRLQKIIKILKSGKSS NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcccctcccacctgccggctcctcagtgctgcgctggtcctgctgctgctcctggcc accaaccaccaggctacaggggctgttgtggccagtgagctgcgctgtcactgcctgaag accctgccaagggttgattttgagaccatccagagcttgactgtgaggtccccggggccc cactgtgcccagacagaagtcatagccactctcaagagcggtcaagaagtttgcctcaac ccccaaggccccaggcttcagaaaatcatcaagatactgaagagcggcaagtccagctga

DBGET integrated database retrieval system