Mus pahari (shrew mouse): 110332655 Help Entry 110332655         CDS       T05929                                  Symbol Tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism mpah  Mus pahari (shrew mouse) Pathway mpah00510   N-Glycan biosynthesis mpah00513   Various types of N-glycan biosynthesis mpah04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mpah00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     110332655 (Tmem258)    00513 Various types of N-glycan biosynthesis     110332655 (Tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110332655 (Tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 Phage_holin_3_3 TctB Motif Other DBs NCBI-GeneID:  110332655 NCBI-ProteinID:  XP_021069625 Ensembl:  MGP_PahariEiJ_G0014177 LinkDB All DBs Position 1:122080809..122084535 Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaagccatgagtaggtataccagcccagtgaacccggctgtcttccctcac ctgactgtggtacttctggccattggcatgttcttcactgcctggttcttcgtttacgag gtcacctctaccaagtatacacgcgatatttacaaagagctcctcatctccttggtggcc tcactcttcatgggctttggagtcctcttcctcctgctctgggttggcatctacgtatga

DBGET integrated database retrieval system