Mus pahari (shrew mouse): 110332760 Help Entry 110332760         CDS       T05929                                  Symbol Il4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04151   PI3K-Akt signaling pathway mpah04630   JAK-STAT signaling pathway mpah04640   Hematopoietic cell lineage mpah04657   IL-17 signaling pathway mpah04658   Th1 and Th2 cell differentiation mpah04659   Th17 cell differentiation mpah04660   T cell receptor signaling pathway mpah04664   Fc epsilon RI signaling pathway mpah04672   Intestinal immune network for IgA production mpah05140   Leishmaniasis mpah05200   Pathways in cancer mpah05310   Asthma mpah05320   Autoimmune thyroid disease mpah05321   Inflammatory bowel disease mpah05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110332760 (Il4)    04151 PI3K-Akt signaling pathway     110332760 (Il4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110332760 (Il4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     110332760 (Il4)    04660 T cell receptor signaling pathway     110332760 (Il4)    04658 Th1 and Th2 cell differentiation     110332760 (Il4)    04659 Th17 cell differentiation     110332760 (Il4)    04657 IL-17 signaling pathway     110332760 (Il4)    04664 Fc epsilon RI signaling pathway     110332760 (Il4)    04672 Intestinal immune network for IgA production     110332760 (Il4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110332760 (Il4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     110332760 (Il4)   09163 Immune disease    05310 Asthma     110332760 (Il4)    05320 Autoimmune thyroid disease     110332760 (Il4)    05321 Inflammatory bowel disease     110332760 (Il4)    05330 Allograft rejection     110332760 (Il4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110332760 (Il4)    00536 Glycosaminoglycan binding proteins [BR:mpah00536]     110332760 (Il4) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interleukins    110332760 (Il4) Glycosaminoglycan binding proteins [BR:mpah00536]  Heparan sulfate / Heparin   Cytokines    110332760 (Il4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Rif1_N Motif Other DBs NCBI-GeneID:  110332760 NCBI-ProteinID:  XP_021069763 Ensembl:  MGP_PahariEiJ_G0017476 LinkDB All DBs Position 14:complement(21658762..21664665) Genome browser AA seq 142 aa AA seqDB search MGLRPQLAVILLFFLECTGNRIHGCNDKHLKEIINILNQVTGEGTPCLEMVVPDIFTARK NTTESELICRASKVLRTFYLEHEILPCLKKNFSVLAQLQRLFRAMRCAKLPKSCTLNESA LTSLKDFLESLKNIVQMDYSQY NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgggtctcaggccccagctagctgtcatcctgctcttctttctcgagtgtaccgggaac cgtatccacggatgcaacgacaaacacttgaaagagatcatcaacattttgaaccaggtc acaggagaagggacgccatgcctcgagatggtcgtgccagacatctttacagcaaggaag aacaccacggagagcgagctcatctgtagggcttccaaggtgcttcgcacattttattta gaacatgagatacttccgtgtttgaagaagaactttagtgttctcgcccagctgcagaga ctctttcgggccatgagatgcgcgaagctaccgaaaagctgcaccctgaatgagtccgcg ctcacatcattgaaagacttcctggaaagcctaaaaaacatcgtgcaaatggattactcg cagtactga

DBGET integrated database retrieval system