KEGG   Mus pahari (shrew mouse): 110333124
Entry
110333124         CDS       T05929                                 
Symbol
Fadd
Name
(RefSeq) FAS-associated death domain protein
  KO
K02373  FAS-associated death domain protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01524  Platinum drug resistance
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04217  Necroptosis
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04657  IL-17 signaling pathway
mpah04668  TNF signaling pathway
mpah04936  Alcoholic liver disease
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05142  Chagas disease
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110333124 (Fadd)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110333124 (Fadd)
   04215 Apoptosis - multiple species
    110333124 (Fadd)
   04217 Necroptosis
    110333124 (Fadd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110333124 (Fadd)
   04621 NOD-like receptor signaling pathway
    110333124 (Fadd)
   04622 RIG-I-like receptor signaling pathway
    110333124 (Fadd)
   04657 IL-17 signaling pathway
    110333124 (Fadd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333124 (Fadd)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110333124 (Fadd)
   05161 Hepatitis B
    110333124 (Fadd)
   05160 Hepatitis C
    110333124 (Fadd)
   05164 Influenza A
    110333124 (Fadd)
   05162 Measles
    110333124 (Fadd)
   05168 Herpes simplex virus 1 infection
    110333124 (Fadd)
   05163 Human cytomegalovirus infection
    110333124 (Fadd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110333124 (Fadd)
   05169 Epstein-Barr virus infection
    110333124 (Fadd)
   05165 Human papillomavirus infection
    110333124 (Fadd)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110333124 (Fadd)
   05152 Tuberculosis
    110333124 (Fadd)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110333124 (Fadd)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110333124 (Fadd)
   05022 Pathways of neurodegeneration - multiple diseases
    110333124 (Fadd)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110333124 (Fadd)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110333124 (Fadd)
SSDB
Motif
Pfam: Death DED
Other DBs
NCBI-GeneID: 110333124
NCBI-ProteinID: XP_021070229
Ensembl: MGP_PahariEiJ_G0013950
LinkDB
Position
1:complement(113889016..113891748)
AA seq 205 aa
MDPFLVLLHSLSGSLSGNDLMELKFLCRERVSKRKLERVQSGLDLFSVLLEQNDLERRHT
GLLRELLASLRRHDLLQRLDDFEAGTAAAAPPGEADLQVAFDIVCDNVGRDWKRLARQLK
LSEAKIDGIEEKYPRSLSEQVRESLKVWKNAEKKNASVAGLVKALRACRLNLVADLVEEA
QGSVSKSEDMSPVLRDSTVSSSETP
NT seq 618 nt   +upstreamnt  +downstreamnt
atggacccattcctggtgctgctgcactcgctgtccggcagcctgtcgggcaacgatctg
atggagctcaagttcttgtgccgcgagcgcgtgagcaaacgaaagctggagcgcgtgcag
agtggcctggacctgttctcggtgctgctggagcagaacgacctggagcgccggcacacc
gggctgctgcgcgagttgctggcctcgctgcgccggcacgatctactgcagcgcctggac
gacttcgaggcggggacggcggccgctgcgcccccgggggaggcagatctgcaggtggca
tttgacattgtgtgtgacaatgtggggagagactggaaaagactggcccgccagctgaag
ttgtctgaggccaagattgatgggattgaggagaagtacccccgaagtctgagcgagcag
gtaagggagagcctgaaagtctggaagaatgccgagaagaagaacgcctcagtggctgga
ctggtcaaggcgctgcgggcctgcaggctgaatctggtggctgacctggtggaagaagcc
cagggatctgtgagcaagagcgaagatatgtcccccgtgctaagggactcaactgtgtct
tcctcagaaacaccctga

DBGET integrated database retrieval system