KEGG   Mus pahari (shrew mouse): 110334054
Entry
110334054         CDS       T05929                                 
Symbol
F12
Name
(RefSeq) coagulation factor XII
  KO
K01328  coagulation factor XII (Hageman factor) [EC:3.4.21.38]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110334054 (F12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110334054 (F12)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mpah04990]
    110334054 (F12)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.38  coagulation factor XIIa
     110334054 (F12)
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110334054 (F12)
Domain-containing proteins not elsewhere classified [BR:mpah04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   110334054 (F12)
SSDB
Motif
Pfam: Trypsin Kringle fn2 EGF fn1 Trypsin_2 DUF1986 hEGF EGF_2
Other DBs
NCBI-GeneID: 110334054
NCBI-ProteinID: XP_021071555
Ensembl: MGP_PahariEiJ_G0019627
LinkDB
Position
16:complement(58148679..58156888)
AA seq 596 aa
MTALLFLGSLLISLDPTLSAPPWKDSKEFKDGPDGPTVVLTVDGRLCHFPFQYHRQLYHK
CIHKRRPGSQPWCATTPNFDEDRQWGYCLEPKKVKDHCSKHSPCHKGGTCVNTPNGPHCL
CPEHLTGKHCQKEKCFEPQLLKFFHENELWFRTGPEGVARCECKGSKAHCKPVASQACSI
NPCLNGGSCLLVEDHPLCRCLAGYTGYFCDLDLWATCYEGRGLSYRGQARTTQSGAPCQR
WTVEATYRNMTEKQALSWGLGHHAFCRNPDNDTRPWCFVWSGDRLSWDYCDLEQCQTPTF
SPLVPESQEESSSQAPSLSHSLNASADYQTSLSETNTVGCGQRFHKRLSSLRRVVGGLVA
LPGSHPYIAALYWGNNFCAGSLIDPCWVLTAAHCLQNRPAPEELTVVLGQDRHNQSCERC
QSLAVRSYRLHEDFSSITYQHDLALLRLQESKTNSCAILSPHVQPVCLPSGTAPPSETVP
CEVAGWGHQFEGAEEYSTFLQEAQVPFISLDRCSNSNVHGDSILPGMLCAGFLEGGTDAC
QGDSGGPLVCEEGTAEHQLTLRGVISWGSGCGDRNKPGVYTDVANYLTWIQKHTAS
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgacggctctgttgttcctagggtctctgctgataagtctggatccaacactttcggcg
ccaccgtggaaagactccaaggagttcaaggatggacctgatgggcccactgtggttctc
actgtggacgggaggctctgccattttccctttcagtaccaccgtcagctgtaccacaaa
tgcatccacaaaaggcggccaggctcccagccctggtgtgctaccacccccaactttgat
gaagatcggcaatggggatactgcttggagcccaagaaagtgaaagaccattgcagcaaa
cacagcccatgccacaaaggagggacatgtgtcaacacccccaatggcccacactgtctc
tgccctgaacacctcactgggaaacattgccagaaagagaaatgctttgagcctcagctt
ctcaagttcttccacgagaatgagctatggtttagaacggggccagaaggtgtggccagg
tgcgagtgcaaaggttctaaggctcattgcaagccggtggccagtcaggcctgcagcatc
aatccgtgccttaatgggggcagctgcctcctagtggaggaccacccactgtgccgttgc
cttgcaggctacaccggatatttttgcgacttggacctttgggcgacctgctatgaaggc
agggggctcagctaccggggccaggctagaactacacagtcgggtgcgccatgtcagcgg
tggaccgtggaggccacctaccggaacatgactgagaagcaagcgctaagctggggcctg
ggccaccacgcattctgccggaacccagataatgacacacgtccatggtgcttcgtctgg
agtggcgacaggctgagctgggactattgcgacctggagcagtgccagacgccaacgttc
tcacctctagtccccgagagtcaggaagagtcctcgtcccaggcaccatctctgtcccac
tcactaaatgcctcggctgattatcagacttctctgtccgagaccaacacggtgggttgc
ggacagaggttccacaagcgactgtcctcgctcaggcgcgtggtgggcggactagtggct
ctgcctgggtcgcacccctacatcgctgcactgtactggggcaacaacttctgcgcaggc
agtctcatcgacccctgctgggtgctgaccgcggctcactgcctgcagaatcggccagcg
cccgaggaactgacagtggtacttggccaagatcgccataaccagagctgcgagcggtgc
cagagtctggctgtgcgctcctaccgccttcacgaggacttctcctccatcacctaccag
cacgacttggctctgctgcgcctgcaggagagcaaaaccaacagttgcgcgatcctgtcg
cctcacgttcagccggtgtgtctgcccagtggcacggccccaccctctgagacagtgccc
tgcgaagtagccggctggggtcaccagttcgagggggctgaagaatattccaccttcctg
caggaggcacaggttccctttatctccctggatcgctgctccaactctaacgtgcacgga
gactccattctccctgggatgctttgcgctggcttcttggagggaggcaccgacgcctgc
cagggagactccgggggccctctggtgtgtgaggaaggaactgcagaacatcagctcacc
ctgcgcggagtcatcagctggggctctggctgtggtgaccgcaacaagcccggagtctac
acggacgtggccaactacctgacttggatccagaaacatactgcttcatag

DBGET integrated database retrieval system