KEGG   Mus pahari (shrew mouse): 110334478
Entry
110334478         CDS       T05929                                 

Gene name
Ptk2
Definition
(RefSeq) focal adhesion kinase 1 isoform X1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04012  ErbB signaling pathway
mpah04062  Chemokine signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04510  Focal adhesion
mpah04670  Leukocyte transendothelial migration
mpah04810  Regulation of actin cytoskeleton
mpah04935  Growth hormone synthesis, secretion and action
mpah05100  Bacterial invasion of epithelial cells
mpah05135  Yersinia infection
mpah05146  Amoebiasis
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05205  Proteoglycans in cancer
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05222  Small cell lung cancer
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110334478 (Ptk2)
   04370 VEGF signaling pathway
    110334478 (Ptk2)
   04151 PI3K-Akt signaling pathway
    110334478 (Ptk2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110334478 (Ptk2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110334478 (Ptk2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110334478 (Ptk2)
   04062 Chemokine signaling pathway
    110334478 (Ptk2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    110334478 (Ptk2)
  09158 Development and regeneration
   04360 Axon guidance
    110334478 (Ptk2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110334478 (Ptk2)
   05202 Transcriptional misregulation in cancer
    110334478 (Ptk2)
   05205 Proteoglycans in cancer
    110334478 (Ptk2)
   05208 Chemical carcinogenesis - reactive oxygen species
    110334478 (Ptk2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110334478 (Ptk2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110334478 (Ptk2)
   05163 Human cytomegalovirus infection
    110334478 (Ptk2)
   05165 Human papillomavirus infection
    110334478 (Ptk2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110334478 (Ptk2)
   05100 Bacterial invasion of epithelial cells
    110334478 (Ptk2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110334478 (Ptk2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110334478 (Ptk2)
   05418 Fluid shear stress and atherosclerosis
    110334478 (Ptk2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110334478 (Ptk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110334478 (Ptk2)
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110334478 (Ptk2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110334478 (Ptk2)
Protein kinases [BR:mpah01001]
 Non-receptor tyrosine kinases
  FAK family
   110334478 (Ptk2)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110334478 (Ptk2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M FERM_F2 Kinase-like Haspin_kinase GIT1_C ABC1
Other DBs
NCBI-GeneID: 110334478
NCBI-ProteinID: XP_021071855
Ensembl: MGP_PahariEiJ_G0019868
LinkDB
Position
17
AA seq 1099 aa
MLLERAGQEALRPTGAVCMEKSGCSPFPVCWAKEYDRYLASSKRMAAAYLDPNLNHTPSS
STKTHLGTGMERSPGAMERVLKVFHYFESGNEPTTWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGML
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKL
ANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDV
HQGVYLSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVW
IIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSS
NDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEIL
MHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQL
STILEEEKVQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHM
VQTNHYQVSGYPGSHGIPAMAGSIYPGQASLLDQTELWNHRPQEMSMWQPSVEDSAALDL
RGMGQVLPPHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSFQGPTG
NQHIYQPVGKPDPAAPPKKPPRPGAPGHLSNLSSISSPADSYNEGVKPWRLQPQEISPPP
TANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIP
VLPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKN
LLDVIDQARLKMLGQTRPH
NT seq 3300 nt   +upstreamnt  +downstreamnt
atgttgttggaacgggcaggccaagaggccctgagacctacaggtgccgtctgtatggag
aaaagcggctgtagtccatttccagtgtgttgggctaaagaatatgacagatacctagca
tctagcaaaagaatggcagctgcttatcttgacccaaacttgaatcacacaccaagttcg
agtactaagactcacctgggtactggcatggaacggtcccctggtgcaatggaacgagta
ttaaaggtctttcattattttgaaagcggtaatgagccaaccacctgggccagtattatc
aggcatggagatgctactgatgtcaggggcatcattcagaagatagtggacagtcacaaa
gtaaagcacgtggcctgctatggatttcgcctcagtcacctgcgatcggaggaggtgcac
tggctgcacgtggacatgggtgtctccagtgtgagggagaaatatgaactcgcccaccca
ccagaggagtggaaatatgagttgagaattcgttacttgccaaaaggatttctaaaccag
tttactgaagataagccaacattgaatttcttctatcaacaggtgaagagtgactacatg
ctagagatagctgatcaagtagaccaagaaatagctttgaagttgggttgtttggaaatt
aggcgatcctattgggagatgaggggcaatgccttagagaagaagtccaactatgaagtg
ttagaaaaagatgttggtttaaagcgattttttcctaagagtttactggattctgtcaag
gccaaaacactaagaaagctgatccagcaaacattcaggcagtttgccaatcttaataga
gaagaaagcatcctgaaattctttgagattctttctcctgtgtacagatttgacaaagag
tgcttcaagtgtgcccttgggtcaagttggattatttctgtggaattggcaatcggccca
gaagaagggatcagttacctgacagacaaaggctgcaatcccacacacctagcagacttt
aaccaagtgcagaccatccagtactcaaacagtgaagacaaagacaggaaaggaatgcta
caactcaaaattgctggtgctcctgagcctctgacagtgacggcaccatccctaaccatt
gcagagaacatggccgacctgatcgatggatactgccggctggtaaatggagccacacaa
tccttcatcatcagaccccagaaagaaggtgaacgggcgttgccatcaataccaaagttg
gccaacagtgaaaagcaaggcatgcggacacatgcagtctctgtgtcagagacagatgac
tatgctgagatcatcgatgaggaagacacatacaccatgccctcgaccagggattatgag
attcagagagaaagaatagaacttggacgctgtattggagaaggtcagtttggagatgta
catcaaggcgtgtacctgagcccagagaatccagctttggctgttgcaatcaaaacatgt
aaaaactgtacttcggacagcgtgagagagaagttccttcaagaagccttaacaatgcgt
cagtttgaccatcctcacatcgtgaagctgattggagtcattacagagaaccctgtctgg
ataatcatggagttgtgcacacttggagagctgaggtcatttttgcaagtaagaaaatac
agcttggatctggcatctttgatcttatatgcctatcagcttagtacagcactcgcgtat
ctggaaagcaaaagatttgttcacagggacattgccgctcggaatgttctggtgtcttca
aatgattgtgtaaaattaggagactttggattatctcgctatatggaagacagtacttac
tataaagcttccaaaggaaaattacctattaaatggatggctccagagtcaatcaatttt
cgacgttttacctcagctagtgacgtgtggatgtttggtgtgtgtatgtgggagatactg
atgcatggcgtgaagccttttcaaggagtgaagaacaatgatgtgatcggtcgaattgaa
aatggggaaagattaccaatgcctccaaattgtcctcctaccctctacagccttatgacg
aaatgttgggcctatgaccccagcaggcggcccaggtttactgaactaaaagctcagctc
agcacaatcctggaggaagagaaggtgcagcaagaagaacggatgaggatggaatccaga
agacaggctaccgtgtcctgggactctggagggtctgatgaagcaccacccaagcccagc
agacctggttatcctagcccgagatccagtgaaggattttatcccagcccacagcacatg
gtccagaccaatcactaccaggtctctggctacccgggttcccatggaatcccagctatg
gctggcagcatttacccaggtcaggcatctcttctggaccagacagaattgtggaatcac
agacctcaggagatgtccatgtggcagcccagtgtggaggactcggcagctttggacctt
cgagggatgggacaggtgctcccccctcacctgatggaagagcggctaatccgacagcag
caggaaatggaagaagaccagcgctggctggagaaggaagagcgattcctgaaacctgat
gtgaggctctctcgaggcagcatcgacagggaggatgggagttttcagggtccgactgga
aaccaacacatctatcagcctgtggggaaaccagatcctgcagctccaccaaagaaacca
cctcgccctggagcacctggccacctaagcaacctgtccagcatcagcagccctgcagac
agctacaatgagggtgtcaagccgtggaggcttcagccccaggaaatcagcccccctccc
actgccaaccttgaccggtccaatgacaaggtatatgaaaatgtgacaggcctagtgaag
gctgtcatcgagatgtccagcaaaatccagccagctcctccagaagagtacgtccctatg
gtgaaggaagttggcctggccctgcggaccttactggccactgtggatgagaccatccct
gttcttccagctagcactcatcgagagatcgagatggcacagaagctactgaactccgac
ttgggtgagctcatcagcaagatgaagctggcacagcagtatgtcatgaccagcctgcag
caggagtacaagaagcagatgctgacagctgctcatgccctggctgtggatgccaagaat
ctacttgatgttattgatcaagcaagactgaaaatgctagggcagacacggccacactga

DBGET integrated database retrieval system