Mus pahari (shrew mouse): 110335791 Help Entry 110335791         CDS       T05929                                  Symbol Tnf Name (RefSeq) tumor necrosis factor isoform X1   KO K03156   tumor necrosis factor superfamily, member 2 Organism mpah  Mus pahari (shrew mouse) Pathway mpah01523   Antifolate resistance mpah04010   MAPK signaling pathway mpah04060   Cytokine-cytokine receptor interaction mpah04061   Viral protein interaction with cytokine and cytokine receptor mpah04064   NF-kappa B signaling pathway mpah04071   Sphingolipid signaling pathway mpah04150   mTOR signaling pathway mpah04210   Apoptosis mpah04217   Necroptosis mpah04350   TGF-beta signaling pathway mpah04380   Osteoclast differentiation mpah04612   Antigen processing and presentation mpah04620   Toll-like receptor signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04622   RIG-I-like receptor signaling pathway mpah04625   C-type lectin receptor signaling pathway mpah04640   Hematopoietic cell lineage mpah04650   Natural killer cell mediated cytotoxicity mpah04657   IL-17 signaling pathway mpah04660   T cell receptor signaling pathway mpah04664   Fc epsilon RI signaling pathway mpah04668   TNF signaling pathway mpah04920   Adipocytokine signaling pathway mpah04930   Type II diabetes mellitus mpah04931   Insulin resistance mpah04932   Non-alcoholic fatty liver disease mpah04933   AGE-RAGE signaling pathway in diabetic complications mpah04936   Alcoholic liver disease mpah04940   Type I diabetes mellitus mpah05010   Alzheimer disease mpah05014   Amyotrophic lateral sclerosis mpah05020   Prion disease mpah05022   Pathways of neurodegeneration - multiple diseases mpah05132   Salmonella infection mpah05133   Pertussis mpah05134   Legionellosis mpah05135   Yersinia infection mpah05140   Leishmaniasis mpah05142   Chagas disease mpah05143   African trypanosomiasis mpah05144   Malaria mpah05145   Toxoplasmosis mpah05146   Amoebiasis mpah05152   Tuberculosis mpah05160   Hepatitis C mpah05161   Hepatitis B mpah05163   Human cytomegalovirus infection mpah05164   Influenza A mpah05165   Human papillomavirus infection mpah05166   Human T-cell leukemia virus 1 infection mpah05168   Herpes simplex virus 1 infection mpah05169   Epstein-Barr virus infection mpah05170   Human immunodeficiency virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05205   Proteoglycans in cancer mpah05310   Asthma mpah05321   Inflammatory bowel disease mpah05322   Systemic lupus erythematosus mpah05323   Rheumatoid arthritis mpah05330   Allograft rejection mpah05332   Graft-versus-host disease mpah05410   Hypertrophic cardiomyopathy mpah05414   Dilated cardiomyopathy mpah05417   Lipid and atherosclerosis mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110335791 (Tnf)    04350 TGF-beta signaling pathway     110335791 (Tnf)    04064 NF-kappa B signaling pathway     110335791 (Tnf)    04668 TNF signaling pathway     110335791 (Tnf)    04071 Sphingolipid signaling pathway     110335791 (Tnf)    04150 mTOR signaling pathway     110335791 (Tnf)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110335791 (Tnf)    04061 Viral protein interaction with cytokine and cytokine receptor     110335791 (Tnf)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     110335791 (Tnf)    04217 Necroptosis     110335791 (Tnf)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     110335791 (Tnf)    04620 Toll-like receptor signaling pathway     110335791 (Tnf)    04621 NOD-like receptor signaling pathway     110335791 (Tnf)    04622 RIG-I-like receptor signaling pathway     110335791 (Tnf)    04625 C-type lectin receptor signaling pathway     110335791 (Tnf)    04650 Natural killer cell mediated cytotoxicity     110335791 (Tnf)    04612 Antigen processing and presentation     110335791 (Tnf)    04660 T cell receptor signaling pathway     110335791 (Tnf)    04657 IL-17 signaling pathway     110335791 (Tnf)    04664 Fc epsilon RI signaling pathway     110335791 (Tnf)   09152 Endocrine system    04920 Adipocytokine signaling pathway     110335791 (Tnf)   09158 Development and regeneration    04380 Osteoclast differentiation     110335791 (Tnf)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     110335791 (Tnf)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110335791 (Tnf)    05170 Human immunodeficiency virus 1 infection     110335791 (Tnf)    05161 Hepatitis B     110335791 (Tnf)    05160 Hepatitis C     110335791 (Tnf)    05171 Coronavirus disease - COVID-19     110335791 (Tnf)    05164 Influenza A     110335791 (Tnf)    05168 Herpes simplex virus 1 infection     110335791 (Tnf)    05163 Human cytomegalovirus infection     110335791 (Tnf)    05169 Epstein-Barr virus infection     110335791 (Tnf)    05165 Human papillomavirus infection     110335791 (Tnf)   09171 Infectious disease: bacterial    05132 Salmonella infection     110335791 (Tnf)    05135 Yersinia infection     110335791 (Tnf)    05133 Pertussis     110335791 (Tnf)    05134 Legionellosis     110335791 (Tnf)    05152 Tuberculosis     110335791 (Tnf)   09174 Infectious disease: parasitic    05146 Amoebiasis     110335791 (Tnf)    05144 Malaria     110335791 (Tnf)    05145 Toxoplasmosis     110335791 (Tnf)    05140 Leishmaniasis     110335791 (Tnf)    05142 Chagas disease     110335791 (Tnf)    05143 African trypanosomiasis     110335791 (Tnf)   09163 Immune disease    05310 Asthma     110335791 (Tnf)    05322 Systemic lupus erythematosus     110335791 (Tnf)    05323 Rheumatoid arthritis     110335791 (Tnf)    05321 Inflammatory bowel disease     110335791 (Tnf)    05330 Allograft rejection     110335791 (Tnf)    05332 Graft-versus-host disease     110335791 (Tnf)   09164 Neurodegenerative disease    05010 Alzheimer disease     110335791 (Tnf)    05014 Amyotrophic lateral sclerosis     110335791 (Tnf)    05020 Prion disease     110335791 (Tnf)    05022 Pathways of neurodegeneration - multiple diseases     110335791 (Tnf)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110335791 (Tnf)    05418 Fluid shear stress and atherosclerosis     110335791 (Tnf)    05410 Hypertrophic cardiomyopathy     110335791 (Tnf)    05414 Dilated cardiomyopathy     110335791 (Tnf)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     110335791 (Tnf)    04940 Type I diabetes mellitus     110335791 (Tnf)    04936 Alcoholic liver disease     110335791 (Tnf)    04932 Non-alcoholic fatty liver disease     110335791 (Tnf)    04931 Insulin resistance     110335791 (Tnf)    04933 AGE-RAGE signaling pathway in diabetic complications     110335791 (Tnf)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     110335791 (Tnf)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110335791 (Tnf)    00536 Glycosaminoglycan binding proteins [BR:mpah00536]     110335791 (Tnf) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Tumor necrosis fators    110335791 (Tnf) Glycosaminoglycan binding proteins [BR:mpah00536]  Heparan sulfate / Heparin   Cytokines    110335791 (Tnf) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  110335791 NCBI-ProteinID:  XP_021073811 Ensembl:  MGP_PahariEiJ_G0020509 LinkDB All DBs Position 18:complement(3126117..3128878) Genome browser AA seq 325 aa AA seqDB search MVFSTKEVFRGLNESFPRPLPQGLAIKAAVCTASQQKLIQRGQQGTSQEGEQKLQNTLEI APRKASSQPGRFCPSHSLARGATSPSRKDTMSTESMIRDVELAEEALPQKMGGLQNSRRC LCLSLFSFLLVAGATTLFCLLNFGVIGPHRDEKFPNGLPLISSMAQTLTLRSSSQNSSDK PVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPD YVLLTHTVSRFAIAYQEKVNLLSAIKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQL SAEVNLPKYLDFAESGQVYFGVIAL NT seq 978 nt NT seq  +upstreamnt  +downstreamnt atggttttctccaccaaggaagttttccgcgggttgaatgagagctttccccgccctctt ccccaagggctggctataaaggcagctgtctgcacagccagccagcagaagctcattcag cgaggacagcaagggaccagccaggagggagaacagaaactccagaacaccctggaaata gctcccagaaaagcaagcagccagccaggcaggttctgtccctctcactcactggcccga ggcgccacatctccctccagaaaggacaccatgagcacagaaagcatgatccgcgacgtg gaactggcagaagaggcactcccccaaaagatggggggcctccagaactccaggcggtgt ctatgtctcagcctcttctcattcctgcttgtggcaggggccaccacgctcttctgtcta ctgaacttcggggtgatcggtccccacagggatgagaagttcccaaatggcctccctctc atcagttctatggcccagaccctcacactcagatcgtcttctcaaaattcgagtgacaag cctgtagcccacgtcgtagcaaaccaccaagtggaggagcagctggagtggctgagccag cgcgccaacgccctcctggccaacggcatggatctcaaagacaaccaactagtggtgccg gccgatgggttgtatcttgtctactcccaggttctcttcaagggacaaggctgccctgac tacgtgctccttacccacaccgtcagccggtttgctatcgcataccaggagaaagttaac ctcctctctgccatcaagagcccctgccccaaggacacccctgagggggctgagctcaag ccctggtatgagcccatatacctgggaggcgtcttccagctggagaagggggaccaactc agcgctgaggtcaacctgcccaagtacttagactttgcggagtccgggcaggtctacttt ggagtcattgctctgtga

DBGET integrated database retrieval system