KEGG   Mus pahari (shrew mouse): 110335791
Entry
110335791         CDS       T05929                                 

Symbol
Tnf
Name
(RefSeq) tumor necrosis factor isoform X1
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01523  Antifolate resistance
mpah04010  MAPK signaling pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04064  NF-kappa B signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04150  mTOR signaling pathway
mpah04210  Apoptosis
mpah04217  Necroptosis
mpah04350  TGF-beta signaling pathway
mpah04380  Osteoclast differentiation
mpah04612  Antigen processing and presentation
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04650  Natural killer cell mediated cytotoxicity
mpah04657  IL-17 signaling pathway
mpah04660  T cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04668  TNF signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04936  Alcoholic liver disease
mpah04940  Type I diabetes mellitus
mpah05010  Alzheimer disease
mpah05014  Amyotrophic lateral sclerosis
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05144  Malaria
mpah05145  Toxoplasmosis
mpah05146  Amoebiasis
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05205  Proteoglycans in cancer
mpah05310  Asthma
mpah05321  Inflammatory bowel disease
mpah05322  Systemic lupus erythematosus
mpah05323  Rheumatoid arthritis
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05410  Hypertrophic cardiomyopathy
mpah05414  Dilated cardiomyopathy
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110335791 (Tnf)
   04350 TGF-beta signaling pathway
    110335791 (Tnf)
   04064 NF-kappa B signaling pathway
    110335791 (Tnf)
   04668 TNF signaling pathway
    110335791 (Tnf)
   04071 Sphingolipid signaling pathway
    110335791 (Tnf)
   04150 mTOR signaling pathway
    110335791 (Tnf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110335791 (Tnf)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110335791 (Tnf)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110335791 (Tnf)
   04217 Necroptosis
    110335791 (Tnf)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110335791 (Tnf)
   04620 Toll-like receptor signaling pathway
    110335791 (Tnf)
   04621 NOD-like receptor signaling pathway
    110335791 (Tnf)
   04622 RIG-I-like receptor signaling pathway
    110335791 (Tnf)
   04625 C-type lectin receptor signaling pathway
    110335791 (Tnf)
   04650 Natural killer cell mediated cytotoxicity
    110335791 (Tnf)
   04612 Antigen processing and presentation
    110335791 (Tnf)
   04660 T cell receptor signaling pathway
    110335791 (Tnf)
   04657 IL-17 signaling pathway
    110335791 (Tnf)
   04664 Fc epsilon RI signaling pathway
    110335791 (Tnf)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110335791 (Tnf)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110335791 (Tnf)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110335791 (Tnf)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335791 (Tnf)
   05170 Human immunodeficiency virus 1 infection
    110335791 (Tnf)
   05161 Hepatitis B
    110335791 (Tnf)
   05160 Hepatitis C
    110335791 (Tnf)
   05171 Coronavirus disease - COVID-19
    110335791 (Tnf)
   05164 Influenza A
    110335791 (Tnf)
   05168 Herpes simplex virus 1 infection
    110335791 (Tnf)
   05163 Human cytomegalovirus infection
    110335791 (Tnf)
   05169 Epstein-Barr virus infection
    110335791 (Tnf)
   05165 Human papillomavirus infection
    110335791 (Tnf)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110335791 (Tnf)
   05135 Yersinia infection
    110335791 (Tnf)
   05133 Pertussis
    110335791 (Tnf)
   05134 Legionellosis
    110335791 (Tnf)
   05152 Tuberculosis
    110335791 (Tnf)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110335791 (Tnf)
   05144 Malaria
    110335791 (Tnf)
   05145 Toxoplasmosis
    110335791 (Tnf)
   05140 Leishmaniasis
    110335791 (Tnf)
   05142 Chagas disease
    110335791 (Tnf)
   05143 African trypanosomiasis
    110335791 (Tnf)
  09163 Immune disease
   05310 Asthma
    110335791 (Tnf)
   05322 Systemic lupus erythematosus
    110335791 (Tnf)
   05323 Rheumatoid arthritis
    110335791 (Tnf)
   05321 Inflammatory bowel disease
    110335791 (Tnf)
   05330 Allograft rejection
    110335791 (Tnf)
   05332 Graft-versus-host disease
    110335791 (Tnf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110335791 (Tnf)
   05014 Amyotrophic lateral sclerosis
    110335791 (Tnf)
   05020 Prion disease
    110335791 (Tnf)
   05022 Pathways of neurodegeneration - multiple diseases
    110335791 (Tnf)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110335791 (Tnf)
   05418 Fluid shear stress and atherosclerosis
    110335791 (Tnf)
   05410 Hypertrophic cardiomyopathy
    110335791 (Tnf)
   05414 Dilated cardiomyopathy
    110335791 (Tnf)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110335791 (Tnf)
   04940 Type I diabetes mellitus
    110335791 (Tnf)
   04936 Alcoholic liver disease
    110335791 (Tnf)
   04932 Non-alcoholic fatty liver disease
    110335791 (Tnf)
   04931 Insulin resistance
    110335791 (Tnf)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110335791 (Tnf)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    110335791 (Tnf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110335791 (Tnf)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110335791 (Tnf)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Tumor necrosis fators
   110335791 (Tnf)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Cytokines
   110335791 (Tnf)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 110335791
NCBI-ProteinID: XP_021073811
Ensembl: MGP_PahariEiJ_G0020509
LinkDB
Position
18
AA seq 325 aa
MVFSTKEVFRGLNESFPRPLPQGLAIKAAVCTASQQKLIQRGQQGTSQEGEQKLQNTLEI
APRKASSQPGRFCPSHSLARGATSPSRKDTMSTESMIRDVELAEEALPQKMGGLQNSRRC
LCLSLFSFLLVAGATTLFCLLNFGVIGPHRDEKFPNGLPLISSMAQTLTLRSSSQNSSDK
PVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPD
YVLLTHTVSRFAIAYQEKVNLLSAIKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQL
SAEVNLPKYLDFAESGQVYFGVIAL
NT seq 978 nt   +upstreamnt  +downstreamnt
atggttttctccaccaaggaagttttccgcgggttgaatgagagctttccccgccctctt
ccccaagggctggctataaaggcagctgtctgcacagccagccagcagaagctcattcag
cgaggacagcaagggaccagccaggagggagaacagaaactccagaacaccctggaaata
gctcccagaaaagcaagcagccagccaggcaggttctgtccctctcactcactggcccga
ggcgccacatctccctccagaaaggacaccatgagcacagaaagcatgatccgcgacgtg
gaactggcagaagaggcactcccccaaaagatggggggcctccagaactccaggcggtgt
ctatgtctcagcctcttctcattcctgcttgtggcaggggccaccacgctcttctgtcta
ctgaacttcggggtgatcggtccccacagggatgagaagttcccaaatggcctccctctc
atcagttctatggcccagaccctcacactcagatcgtcttctcaaaattcgagtgacaag
cctgtagcccacgtcgtagcaaaccaccaagtggaggagcagctggagtggctgagccag
cgcgccaacgccctcctggccaacggcatggatctcaaagacaaccaactagtggtgccg
gccgatgggttgtatcttgtctactcccaggttctcttcaagggacaaggctgccctgac
tacgtgctccttacccacaccgtcagccggtttgctatcgcataccaggagaaagttaac
ctcctctctgccatcaagagcccctgccccaaggacacccctgagggggctgagctcaag
ccctggtatgagcccatatacctgggaggcgtcttccagctggagaagggggaccaactc
agcgctgaggtcaacctgcccaagtacttagactttgcggagtccgggcaggtctacttt
ggagtcattgctctgtga

DBGET integrated database retrieval system