KEGG   Mus pahari (shrew mouse): 110335909
Entry
110335909         CDS       T05929                                 
Symbol
C4a
Name
(RefSeq) complement C4-A isoform X1
  KO
K03989  complement component 4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah04936  Alcoholic liver disease
mpah05133  Pertussis
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110335909 (C4a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110335909 (C4a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110335909 (C4a)
   05150 Staphylococcus aureus infection
    110335909 (C4a)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110335909 (C4a)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110335909 (C4a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110335909 (C4a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335909 (C4a)
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   110335909 (C4a)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   110335909 (C4a)
  Exosomal proteins of other cancer cells
   110335909 (C4a)
SSDB
Motif
Pfam: TED_complement A2M A2M_recep A2M_BRD NTR MG2 MG3 ANATO MG4
Other DBs
NCBI-GeneID: 110335909
NCBI-ProteinID: XP_021074003
Ensembl: MGP_PahariEiJ_G0020469
LinkDB
Position
18:complement(2737767..2746434)
AA seq 1738 aa
MRLLWGLTWVFSFFASSLQKPRLLLFSPSVVNLGTPLSVGVQLLDAPPGQEIKGSVFLRT
PTGGSCSPKKEFKLSSGDDFVLLSLEVPLKDVRSCGLFDLRRAPHIQLVAQSPWLRNIAS
KATETQGVNLLFSSRRGHIFVQTDQPIYNPGQRVRYRIFALDQKMRPSTDYLTVTVENSR
GFRVLKKELFSSTSIFQDDFIIPDISEPGTWKISARFSDGLESNRSTHFEVKKYVLPNFE
VKITPWKPYILMVPSNHDEIQLDIQARYIYGKPVKGVAYTRFALMDEQGKRTFLRGLETQ
SRLVEGETHISISKHQLQAALDKIHIEVRDLEGLRLYTATAVIESPGGEMEEAELTSWHF
VTSAFSLDLSRTKRHLVPGAHFLLQALVREISGSEASNVPVKVSATLVSGSDSQVLDIQQ
STNGIGQVSVSFPIPPTITELRLLVSAGSLYPAIARLTVQAPPSRGTGFLSIEPLDPRSP
RVGDTFILNLQAVGIHAPTFSHYYYMIISRGQIMAMSREPRRTVTSVSVLVGHQLAPSFY
FVAYFYHQGLPVANSLLINIQPGDCEGKLELKVTGAKEYRNADRMTLQLQTDSKALVALG
AVDTALYAVGGRSHKPLDMNKVFEVINSYNLGCGPGGGDDALQVFQDAGLAFSDGDRLTQ
TREDLRCPKEKKSRQKRSANFLKAVSEKLGQYSSPDAKRCCQDGMTKLPMERTCDQRAAR
VPQPACRQPFLSCCKFAEDLRRNQTRSQAGLARDYQDVMQEEDLIDEDDILVRSYFPENW
LWRVEQVDSSKLLTVWLPDSMTTWEIHGVSLSKSKGLCVAKPTRVRVFRKFHLHLRLPVS
VRRFEQLELRPVLYNYLNDNVTVSVHVTPVEGLCLAGGGMLAQQVTVPAGSGRPVAFSVV
PTAAANVPLKVVARGVFDLGDAVSKILQIEVKGAIHREEIVYNLDPLNNLGRTLEIPGSS
DPNMVPDGDFSSFVRVTASEPLETLGSEGALSPGGVASLLRLPRGCAEQTMVYLAPTLTA
SNYLDRTEQWSKLSPETKDHAVDLIQKGHMRIQQFRKKDGSFGAWLHRDSSTWLTAFVLK
ILSLAQQQVGDSPEKLQETATWLLAQQLGDGSFHDPCPVIHRGMQGGLVGTDETVALTAF
VVIALHHGLDVFRDENAKQLKNRVEASITKANSFLGQKASAGLLGAHAAAITAYALTLTE
ASEDLRNVAHNSLMAMAQETGENLYWGLVTGSQDNAVSPPAKPLSPTEPVPQAPALWIET
TAYALLHLLLREGRGKKADKAASWLTHQGSFHGAFRSTQDTVVTLEALSAYWIASHTTEE
KALNVTLSSMGRYGFKTHVLHLNNHQVKGLEEELKFSLGSTISVKVGGNSKGTLKILRTY
NVLDMKNTTCQDLQIEVTVTGSVEYTRDAIEDYEEDYDMPAADDPSVPSQPVTPLQLFEG
RRSRRRREAPKVAEEQESRVQYTVCIWRSGKLGLSGMAIADITLLSGFHALRADLEKLTS
LSDRYVSHFETDGPHVLLYFDSVPTSRECVGFGASQEVAVGLVQPASAVLYDYYSPDHKC
SVFYAAPTKSQLLSTLCSGDVCQCAEGKCPRLLRSLERGVEDKDGYRMRFACYHPRVEYG
FTVKVLREDGRAAFRLFETKITQVLHFRKDTMASIGQTRNFLSRASCRLRLEPNKEYLIM
GLDGETSDNKGDPQYLLDSNTWIEEMPSEHLCKSTRQRAACTQLKDFLREYSSRGCQV
NT seq 5217 nt   +upstreamnt  +downstreamnt
atgcggctcctctgggggctgacctgggtgttcagcttctttgcctcatccctgcagaag
cccaggttgctcctgttttccccttctgtggttaatttggggacccccctatcggtgggg
gtacagctcctggatgcccctccaggacaggagataaaaggatcagtgttcctcagaacc
ccaacgggtggctcctgctccccaaagaaggaatttaagctgagctcgggagacgacttt
gtgctgctcagccttgaggtcccactgaaagatgtgaggagctgtggcctctttgacctg
cgcagagccccccacatccagctggtagctcagtctccgtggctaaggaacatagcatcc
aaagccacagagacccagggtgtcaacctgctcttctcttcccgacgaggccacatcttt
gtgcagaccgatcagcctatctataaccctgggcagcgggttcgttaccggatctttgca
ctggaccaaaagatgcgcccatccactgattacctcaccgtcacagtggagaactcccgt
ggcttccgtgtactcaagaaggagctattttcttccacatccatcttccaagatgacttc
atcattccagacatctcagagcctgggacctggaagatctcagctaggttctcagatgga
ctggagtccaataggagcacccactttgaagtaaagaaatatgtccttcccaactttgag
gtgaagattactccttggaaaccatatatcctgatggtgcccagcaaccatgatgaaatc
cagttagacatccaggccaggtacatctatgggaagcccgtgaagggtgtggcatacaca
cggttcgcgctcatggatgagcaagggaagaggaccttccttcggggcctagagacccag
agtaggttggtggaaggcgagacccacatctccatctcgaagcaccagttgcaggctgcc
ctggataaaatccatattgaggtcagagacctggaggggctgcgtctctacactgctaca
gccgtcatcgagtctccaggaggagagatggaggaggctgaactcacgtcctggcacttt
gtgacatctgccttctccttggatctcagccgcactaagcggcatcttgtgcccggggcc
cacttcctgctgcaggccttggtccgagaaatatcaggctctgaagcctccaacgttcct
gtcaaagtctctgccaccttggtgtcgggctctgactcgcaagtcctcgacattcaacag
agcaccaatggaattggccaagtcagcgtttccttccccatcccgccaaccatcacagaa
ctccggctcttggtgtctgcgggctccctctacccagccatagccaggctcactgtgcaa
gctccaccttcaagaggcactggctttctgtctattgagccactagaccctcggtcccct
cgtgtgggggacaccttcatcctaaaccttcaagctgtgggcatccatgcacctaccttc
tctcattactactacatgatcatctccagaggccagatcatggctatgagtcgggagccc
cggaggaccgtgacctccgtctccgtgttggtgggccatcagctggctccctcgttctac
tttgtggcctacttctatcaccaaggactcccagtggccaactctctgctcatcaacatc
cagcccggggactgtgagggcaagttggaattgaaggtgactggtgccaaggagtatcgt
aacgcagacagaatgacgctccaacttcaaacggactccaaagccctggtggcactggga
gctgtggacacggctctgtatgctgtgggtggtcgatctcacaaaccccttgacatgaac
aaggtctttgaagtaatcaacagctacaaccttggctgtggtcctggaggtggggatgat
gcccttcaggtgttccaggatgctggtctggccttttctgatggtgatcgactaactcaa
accagagaggacctgagatgtcccaaggagaagaaaagtcggcaaaagcgaagtgctaac
ttcctgaaggctgtcagtgagaagttgggccagtattcttctccagacgccaagcgctgc
tgccaagacgggatgacgaagctgcccatggagcgtacctgtgatcagcgggctgcccgc
gtgcctcagccggcctgccgccagcccttcttgtcctgttgcaagtttgctgaggacctt
cgcaggaaccagaccaggagccaggcgggccttgcccgagactatcaggacgtgatgcag
gaggaggatctgatagatgaagatgacattctcgtgcgcagctacttcccagagaactgg
ctctggagagtggaacaagtggacagctccaaactgttgacagtgtggcttcctgactct
atgaccacatgggagattcatggtgtgagcctgtccaaaagcaaaggcctgtgcgtagcc
aagccaactcgtgttcgagtgttccgaaaattccacctgcacctgcgcctgcctgtctcc
gtccgccgctttgagcagcttgaattacggcctgttctctacaactatctgaatgataat
gtgactgtgagtgtccatgtaaccccagtggaggggctgtgcctggctggtggtggaatg
ctggcccagcaggtaacagtgcctgcaggttctggccggcctgtggccttctctgtggta
cccacagctgctgccaacgtgcccctcaaagtggtggctcgaggggtttttgacttaggg
gatgctgtgtctaagattctccaaattgaggtgaaaggggccatccacagagaggagata
gtctacaacctcgaccccctaaataacctaggtcggactttggagattcctggcagctcg
gatcccaacatggtccctgacggagacttcagcagcttcgtcagggttacagcctctgaa
cccttggagactctgggctctgaaggagccttgtccccaggaggcgtggcctccctcctg
aggcttccccggggctgcgcggagcaaaccatggtctatttggcccctaccctgacggct
tccaactacctggacaggacagaacagtggagtaaactgtcccctgagacaaaggaccat
gctgtggatctgatccagaaaggccacatgaggatccagcagtttcggaagaaagatggc
tcctttggggcgtggttacaccgggacagcagcacctggctgactgcctttgtgctgaag
attctgagtttggcccagcaacaggtgggcgactcccccgagaagctgcaggagacagct
acctggctgctggcccagcagctgggcgatggctccttccacgacccatgtccagtcatc
catagaggcatgcaggggggcttggtggggaccgacgagacggtggcactgacggccttt
gtggtcattgcccttcaccacggtctggatgtcttccgggacgagaatgcgaagcagctg
aagaacagagtggaagcctccatcaccaaggcaaactcgttcttggggcagaaggcaagt
gccgggctcctgggtgcccacgccgccgccatcacagcctatgccctgacgctgaccgag
gcctcggaggacctgcggaatgttgcccacaacagcctgatggccatggctcaggaaacg
ggggaaaacctctactggggcttagtcactggctctcaggacaacgctgtgtcgccccca
gcaaaaccccttagcccaacagaacctgtgccccaggccccagccctgtggatcgaaacc
acagcctatgccctgctccacctgcttctgcgggagggaagggggaaaaaggctgacaaa
gctgcatcctggctcacccaccagggaagcttccacggggcattccgcagtacccaggac
actgtggtcaccctggaggccctgtctgcctactggatcgcttcacacaccaccgaggag
aaagcactgaatgtgacactcagctccatgggccgctatgggttcaagacccatgtgcta
cacttgaacaaccaccaagtcaaaggcctggaggaagagctgaagttctccctgggcagc
acaatcagtgtgaaagtgggaggaaacagcaaaggcaccttgaagatccttcgtacctac
aatgtcctggacatgaagaacaccacgtgccaggaccttcagatagaagtgacggtcaca
ggctctgtggaatatacaagggatgccattgaagactacgaagaggactatgacatgcca
gctgcagatgaccccagcgtcccctcacagcctgtgactcccctgcagctgtttgagggt
cgtcggagccgccgcaggagggaggcccccaaggtggccgaagagcaggagtccagagtt
cagtacacagtgtgtatctggcgcagtggcaagctggggctgtctggcatggccatcgca
gacatcaccctcctgagtggattccacgccctgagggctgacctggagaagctgacctcc
ctctctgaccgttacgtgagtcactttgagactgacgggccccatgtcctgttgtacttt
gactcggtcccaacctcccgggagtgtgtgggcttcggagcctcgcaggaggtggccgtg
ggactggtgcagccagccagcgctgtcctgtatgactactacagccccgatcacaagtgt
tctgtgttttatgctgcacccaccaagagtcagctcctgtccaccctgtgctctggagat
gtctgccagtgtgctgaggggaagtgtcctcgactgctaaggtcactggagcgaggggtg
gaggacaaggacggttaccggatgaggttcgcctgctatcatccccgagtggagtatggg
ttcacggttaaggttctccgagaagatgggagagctgccttccgcctctttgagaccaag
atcacccaagtcctgcatttcagaaaggacaccatggcctccataggacagacccgcaac
ttcctaagcagggcctcttgccgccttcgtttggagcctaacaaagagtacttgatcatg
gggctggacggggaaaccagtgacaacaagggagacccccagtacttgctggactcaaac
acctggattgaggaaatgccttcggaacacctgtgtaagagcacccgccagcgggcagcc
tgtacccagctcaaggacttcctgagggagtacagcagccgggggtgccaggtttga

DBGET integrated database retrieval system