KEGG   Mus pahari (shrew mouse): 110336317
Entry
110336317         CDS       T05929                                 

Gene name
Insr
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04520  Adherens junction
mpah04910  Insulin signaling pathway
mpah04913  Ovarian steroidogenesis
mpah04923  Regulation of lipolysis in adipocytes
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04960  Aldosterone-regulated sodium reabsorption
mpah05010  Alzheimer disease
mpah05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110336317 (Insr)
   04014 Ras signaling pathway
    110336317 (Insr)
   04015 Rap1 signaling pathway
    110336317 (Insr)
   04066 HIF-1 signaling pathway
    110336317 (Insr)
   04068 FoxO signaling pathway
    110336317 (Insr)
   04072 Phospholipase D signaling pathway
    110336317 (Insr)
   04022 cGMP-PKG signaling pathway
    110336317 (Insr)
   04151 PI3K-Akt signaling pathway
    110336317 (Insr)
   04152 AMPK signaling pathway
    110336317 (Insr)
   04150 mTOR signaling pathway
    110336317 (Insr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110336317 (Insr)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110336317 (Insr)
   04923 Regulation of lipolysis in adipocytes
    110336317 (Insr)
   04913 Ovarian steroidogenesis
    110336317 (Insr)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110336317 (Insr)
  09149 Aging
   04211 Longevity regulating pathway
    110336317 (Insr)
   04213 Longevity regulating pathway - multiple species
    110336317 (Insr)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110336317 (Insr)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    110336317 (Insr)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110336317 (Insr)
   04932 Non-alcoholic fatty liver disease
    110336317 (Insr)
   04931 Insulin resistance
    110336317 (Insr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110336317 (Insr)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110336317 (Insr)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110336317 (Insr)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   110336317 (Insr)
CD molecules [BR:mpah04090]
 Proteins
  110336317 (Insr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like Insulin_TMD fn3 Kinase-like DUF4476
Other DBs
NCBI-GeneID: 110336317
NCBI-ProteinID: XP_021074437
Ensembl: MGP_PahariEiJ_G0021238
LinkDB
Position
19
AA seq 1384 aa
MGFGRGCETTAVPLLVAVAALLVGTAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDVCPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHKECL
GNCSEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNFSFCQDLHFKCRNSRKPG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCQILEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVT
FSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVY
WERQAEDSELFELDYCLKGLKLPSRTWSPPFESDDSQKHNQSEYDDSASECCSCPKTDSQ
ILKELEESSFRKTFEDYLHNVVFVPRKTSSGNGAEDSRPSRKRRSLEEVGNMTATTPTLP
DFPNISSTIVPTSQEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAA
YVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHL
CVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKII
IGPLIFVFLFSVVIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPSSVYVPDEWEV
PREKITLLRELGQGSFGMVYEGNAKDIIKGEAETRVAVKTVNESASLRERIEFLNEASVM
KGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSHLRSLRPDAENNPGRPPPTLQEMIQ
MTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLL
PVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDPP
DNCPERLTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFYSEENKAPESEELE
LEFEDMENVPLDRSSHCQREEAGGREGGSSLSIKRTYDEHIPYTHMNGGKKNGRVLTLPR
SNPS
NT seq 4155 nt   +upstreamnt  +downstreamnt
atgggcttcgggagaggatgtgagacgacggctgtgccgttgctggtggccgtggccgcg
ttgctggtgggcacagccggccacctgtaccctggagaggtgtgccctggaatggacatc
cggaacaacctgaccagactgcatgagctggagaactgctcggtcattgagggccatcta
cagatcctcctgatgttcaagaccagacctgaagatttccgagacctcagtttccccaaa
ctcatcatgatcactgactacctgcttcttttccgtgtctatggcctggagagtctgaaa
gacctctttccaaacctcacagtcatccgaggatcccgtctcttcttcaactatgccctg
gttatcttcgagatggtccacctgaaggagctggggctttacaacctcatgaacatcacc
cggggctccgtccgcatcgagaagaacaatgagctctgctacctggccactatcgactgg
tcccggatcctggattctgtggaggacaactacattgtactgaacaaagatgacaacgag
gaatgtggggacgtctgtccagggaccgccaagggcaagaccaactgccctgccactgtc
atcaatgggcagtttgtggaacggtgctggacacacagtcattgtcagaaagtttgccca
accatctgtaagtcacatggctgtacagctgaaggcctgtgctgccacaaggagtgcctg
ggcaactgttcggaacctgatgaccccaccaagtgtgtggcctgtcgcaacttctacctg
gatggtcagtgtgtggagacctgcccgccaccctactatcacttccaggactggcgctgt
gtgaacttcagcttctgccaagaccttcacttcaaatgcaggaactctcggaagcccggc
tgccaccaatacgtcattcacaacaacaagtgcatccccgagtgcccgtctggctatacc
atgaattccagcaacttgatgtgcaccccatgtctgggaccctgccctaaggtctgccaa
atcctcgaaggtgagaagaccatcgattctgtgacatctgcccaggagctccgaggctgc
actgtgatcaacggcagcctgatcatcaacatccgagggggcaacaacctggcagctgag
ctggaggctaaccttggcctcattgaagaaatttcggggtttctaaagatccgccgctcc
tatgctctggtatcactttctttcttcaggaagctgcatctgattcgaggagagaccttg
gaaattgggaactattctttctatgccttggacaaccagaacctgaggcaactctgggac
tggagcaaacacaacctcaccatcactcagggcaagctcttcttccattacaacccgaaa
ctctgcttgtctgaaattcacaagatggaagaagtctccggaactaagggccgccaggag
aggaacgacattgccctgaagaccaatggggaccaggcatcgtgtgaaaatgaattgctt
aaattttctttcattcggacatcttttgacaagatcctgttgaggtgggagccctactgg
ccccccgacttccgagatctcctgggattcatgctgttctacaaagaggccccttaccag
aacgtgacagagtttgatgggcaggacgcttgtggctccaacagctggaccgtggtggat
attgacccgccccagagatccaacgaccccaagtctcagaccccaagccaccctgggtgg
ctgatgcggggcctcaaaccctggacccaatacgccatctttgtcaagaccttggttacc
ttctctgatgaacggcggacctatggagccaaaagtgatatcatctatgtgcaaacagat
gccactaatccttctgtccccctggatcccatatcagtttctaattcctcatctcagatt
atcttaaagtggaagcccccctccgaccccaatggcaacatcacgcactacctggtctac
tgggagaggcaggcagaggacagcgagctgtttgagctggattattgtctcaaagggctg
aagctcccctcacggacctggtccccaccttttgagtctgatgattctcagaagcacaat
cagagtgagtatgacgactcggccagtgagtgctgctcatgtcctaagactgactctcag
atcctgaaggagctggaggagtcttcattcaggaagaccttcgaggattacctgcacaac
gtggtttttgtccccagaaaaacctcttcaggcaatggtgccgaggacagtaggccatcc
cgaaagcgaagatcccttgaagaggtggggaacatgacagccaccacgcccacacttcca
gatttccccaacatctcctccaccattgtgcccacaagccaggaggaacacaggccattt
gagaaagtggtaaacaaggagtcactcgtcatctctggcctgagacacttcactgggtac
cgcattgagctgcaggcatgcaatcaagattccccagaagagcggtgcagcgtggctgcc
tacgtcagtgcacggaccatgcctgaagctaaggcagatgacatcgttggccctgtgacc
catgaaatctttgagaacaatgttgtacacttaatgtggcaagagccaaaggaacctaat
ggtctgattgtgctgtatgaagtgagctatcgccgatatggtgatgaggagctgcacctc
tgtgtctcccggaagcattttgccctggagcggggctgcaggctgcgagggctctcccca
ggaaactacagtgttcgagtccgggctacctctctggcaggaaacggctcctggacagaa
cccacctatttttatgtgactgattatttagatgtcccgtcaaatattgccaaaattatc
atcgggcccctcatctttgtcttcctcttcagtgttgtgatcggaagtatttatctattc
ctgagaaagaggcagccggatgggccaatgggaccactgtacgcatcttcaaaccctgag
tacctcagtgccagtgatgtgtttccttcttctgtgtacgtgccggacgagtgggaggtc
cctcgagagaagatcaccctccttcgagagctggggcagggatcctttggtatggtgtat
gaaggcaatgccaaggatatcatcaagggtgaggcagagacccgcgttgcggtgaagact
gtcaatgagtcagccagtcttcgagaacggattgagttcctcaatgaggcatcggtcatg
aaggggtttacctgccatcatgtggtccgccttcttggagtggtatccaaaggacagcca
acgctggtagtgatggaattgatggctcatggagacctgaaaagtcacctccgttctctg
aggccagatgctgagaataacccaggccgccctccccctaccttgcaagaaatgattcag
atgacagcagaaattgctgatggcatggcatacttgaacgccaagaagtttgtgcaccgg
gacctggcagctcgaaactgcatggttgcccatgattttactgtcaaaattggagacttc
ggaatgacaagagacatctacgagacagattactatcggaaagggggcaagggactgctg
cctgtgaggtggatgtcacccgagtccctgaaggatggagtctttactgcgtcttctgat
atgtggtcctttggggtggtcctttgggaaatcactagcctggctgagcaaccttatcaa
ggcctgtctaatgaacaggtgttgaagtttgtcatggatggaggctatctggatccccct
gataattgtccagagagactcactgacctgatgcgcatgtgctggcagttcaaccccaag
atgaggccaaccttcctggaaatcgtcaacctgctcaaggatgacctccaccccagtttt
ccagaagtttccttcttctacagcgaggagaacaaggctccggagagtgaggagctggag
ctggagtttgaggacatggagaatgtccccttggatcgttcttctcactgtcagagagaa
gaggcggggggccgggagggagggtcctctctgagcatcaaacggacctatgatgaacac
atcccctatacccacatgaacgggggcaagaagaacgggcgtgtcctcaccctgccaagg
tcaaacccttcctaa

DBGET integrated database retrieval system