KEGG   Mus pahari (shrew mouse): 110336368
Entry
110336368         CDS       T05929                                 
Symbol
Nectin2
Name
(RefSeq) nectin-2 isoform X1
  KO
K06531  poliovirus receptor-related protein 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04520  Adherens junction
mpah05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110336368 (Nectin2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110336368 (Nectin2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110336368 (Nectin2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110336368 (Nectin2)
   04090 CD molecules [BR:mpah04090]
    110336368 (Nectin2)
Cell adhesion molecules [BR:mpah04515]
 Immunoglobulin superfamily
  Nectin family
   110336368 (Nectin2)
CD molecules [BR:mpah04090]
 Proteins
  110336368 (Nectin2)
SSDB
Motif
Pfam: C2-set_2 ig Ig_3 V-set Ig_2 I-set
Other DBs
NCBI-GeneID: 110336368
NCBI-ProteinID: XP_021074529
Ensembl: MGP_PahariEiJ_G0021167
LinkDB
Position
19:complement(15255049..15288897)
AA seq 530 aa
MARAAVLPPSRLSPTLPLWPLLLLLLQETGAQDVRVRVLPEVRGRLGGTVELPCHLLPPT
TERVSQVTWQRLDGTVVAAFHPSFGVDFPNSQFNKERLSFVRARPETNADLRDATLAFRG
LRVEDEGNYTCEFATFPNGTRRGVTWLRVIAQPENHAEAQEVTIGPQSVAVARCVSTGGR
PPARITWISSLGGEAKDIQEPGIQAGTVTVISRYSLVPVGRADGVKVTCRVEHESFEEPI
LLPVTLSVRYPPEVSISGYDDNWYLGRSEAILTCDVRSNPEPTGYDWSTTSGVFPASAVV
QGSQLLVHSVDRLVNTTFICTATNAVGTGRAEQVILVRESPSTAGAGATGGIIGGIIAAI
IATAVAGTGILICRQQQKEQRLQAADEEEELEGPPSYKPPTPKAKLEEPEMPSQLFTLGA
SEHSPVKTPYFDAGVSCADQEMPRYHELPTLEERSGPLLLGATGLGPSLLVPPGPNVVEG
VSLGLEDEEEDDEEEDFLDKINPIYDALSYPSPSDSYQSKDFFVSRAMYV
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggcccgggccgcagtcctcccgccgtccagattgtcaccgacgctgccgttgtggccg
ctgctactgctcctgcttcaggaaacaggagcccaagatgtgcgggtacgagtgcttccc
gaagttcggggccgcttgggaggcaccgtggagttaccgtgccacctgctcccacccacg
acggagcgcgtctctcaggtgacctggcagcgcctggatggcaccgttgtggctgctttt
cacccatccttcggcgtggatttccccaactctcagttcaacaaggagcggctgtccttt
gtcagagcgagaccggaaacaaacgcggacctgagggatgccacgctggccttccgggga
ctgagggtggaggacgagggcaattacacctgcgagtttgccacgtttcccaacggtacc
cgcaggggggtgacctggctcagagtcatagcccagcctgagaaccacgctgaagcccag
gaggtcacaattggcccccagtcggtggctgttgcccgctgtgtctccactgggggccgc
ccccctgcccgaatcacctggatctcatcccttggcggagaggccaaagatattcaggag
ccagggatacaggctggcacggtcactgtcatcagccgatactccttggtgcccgtgggc
cgagcggatggcgtcaaggtcacgtgcagagtggaacatgagagcttcgaagagccgatc
ctgctgccggtgaccctctccgtgcgctaccctccagaagtatccatctccggctatgat
gacaactggtaccttggccgcagtgaggccatattgacctgtgatgtaagaagcaaccca
gagcccacaggctatgactggagcacgacctcgggcgtcttcccagcttccgcagtggtc
cagggctctcagctgcttgtccactctgtggatcgactggtcaacactaccttcatctgt
acagccaccaatgctgtggggacaggccgtgctgagcaggtcatcctggtgcgagagtca
cccagcacagcaggagcaggggccacaggtggcatcatcggaggcatcatcgctgccatc
atcgccaccgcagtggctggcacaggcatcctcatctgccgacaacagcagaaggagcag
aggcttcaagctgcggacgaggaagaagaactggaaggacctccctcctataagccaccc
accccgaaggccaagctggaggaaccagagatgccctctcaactcttcaccttgggggcc
tcagagcacagcccagtgaagacgccatactttgatgctggtgtctcttgtgctgatcag
gagatgcctcggtatcacgagctgcccaccctggaagagcggtcagggcccctgctgttg
ggggctacaggcctgggaccttctcttctggtgcctccaggacccaatgttgtggagggg
gtttccctgggtctcgaagatgaggaggaagatgacgaggaggaagacttcctggataaa
atcaaccctatttatgatgccctgtcctaccccagcccctctgactcctaccagagcaaa
gacttttttgtgtcacgggccatgtatgtgtga

DBGET integrated database retrieval system