KEGG   Mus pahari (shrew mouse): 110338193
Entry
110338193         CDS       T05929                                 
Symbol
Plg
Name
(RefSeq) plasminogen
  KO
K01315  plasminogen [EC:3.4.21.7]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04610  Complement and coagulation cascades
mpah05150  Staphylococcus aureus infection
mpah05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110338193 (Plg)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110338193 (Plg)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    110338193 (Plg)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110338193 (Plg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110338193 (Plg)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110338193 (Plg)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.7  plasmin
     110338193 (Plg)
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110338193 (Plg)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110338193 (Plg)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 110338193
NCBI-ProteinID: XP_021077124
Ensembl: MGP_PahariEiJ_G0023368
LinkDB
Position
21:complement(4465257..4506868)
AA seq 812 aa
MDHKEVILLFLLLLKPGQGDLLDDYISTQGASLFSLTKKQLTAGGVADCLTKCEGETDFV
CRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECKTGIGNGYRGTMSRTKS
GVTCQKWGATFPHIPNYSPSTHPNEGLEENYCRNPDNDEKGPWCYTTDPDQRYDYCNIPE
CEEECMYCNGEKYEGKISKTMSGLDCQAWGSQSPHTHGYIPDKFPSKNLKMNYCRNPDGE
PRPWCFTTDPNKRWEYCDIPRCTTPPPPPGPTYQCLKGRGENYRGTVSVTVSGKTCQRWS
EQTPHRHNRTPENFPCKNLEENYCRNPDGESAPWCYTTDSQLRWEYCEIPSCEASASPDQ
SDSSVLPEEETPVVQECYQGNGQSYRGTSSTTITGKKCQSWVAMVPHRHSKTPENFPDAG
LEMNYCRNPDDDKGPWCYTTDPSVRWEYCNLKRCSETGGSVAELPTVSQVPSGPGNSETD
CMNGNGKDYRGKRAVTAAGTPCQGWAAQEPHRHSIFTPQTNPRAGLEKNYCRNPDGDVNG
PWCYTTNPRKLYDYCDIPLCASSSSFECGKPQVEPKKCPGRVVGGCVANPHSWPWQVSLR
TRFTGQHFCGGTLIAPEWVLTAAHCLEKSSRPEFYKVILGAHEEYTRGSDVQEISVAKLI
LEPNKRDIALLKLSRPATITNKVIPACLPPPNYVVADRTICYITGWGETQGTFGAGRLKE
AQLPVIENKVCNRIEYLNNRVQPTELCAGHLAGGVDSCQGDSGGPLVCFEKDKYILQGVT
SWGLGCARPNKPGVYVRVSQFVNWIEREMRNN
NT seq 2439 nt   +upstreamnt  +downstreamnt
atggaccataaggaagtaatccttctgtttctcttgcttctgaaaccaggacaaggggac
ttgctggatgactacataagcacacaaggggcttcattgttcagtctcaccaagaagcag
ctcacggcaggaggcgtggcggactgtttgaccaaatgtgaaggggaaacagacttcgtc
tgcaggtcattccagtaccatagcaaagagcagcagtgcgtgatcatggcggagaacagc
aagacttcctccatcatccggatgagagacgtcatcttattcgaaaagagagtgtatctg
tcagaatgtaagaccggcattggcaatggctacagaggaaccatgtccaggacaaagagt
ggtgttacctgtcaaaagtggggtgccacgttcccccacatccccaactactctcccagt
acacatcccaatgagggactagaagagaactactgtaggaacccagacaatgatgagaaa
gggccctggtgctacacgacagacccggaccagagatacgactactgcaacatccctgaa
tgcgaagaggaatgcatgtactgcaatggagaaaagtatgagggcaaaatctccaagacc
atgtctggacttgactgccaggcctggggttctcagagcccacatactcacggatacatc
cctgacaaatttccaagcaagaacttgaagatgaattattgccgcaaccctgacggggag
ccacgaccctggtgcttcaccacagaccccaacaaacgctgggaatactgtgacatcccc
cgctgcacaacacccccgcccccacccggcccaacctaccaatgtctgaagggaagaggt
gaaaattaccgagggaccgtgtctgtcaccgtatccgggaagacctgtcagcgctggagt
gagcaaacccctcataggcacaacaggacaccagagaatttcccctgcaaaaatctggaa
gagaactactgccggaacccagatggagaatctgctccctggtgctataccactgacagc
cagctgaggtgggagtactgtgagattccgtcctgcgaggcctcagcatcacctgaccag
tcagattcctcagttctaccagaggaggaaacacctgtggtccaggaatgctaccagggc
aatgggcagagctatcggggcacatcgtccactaccatcacagggaagaagtgccagtcc
tgggtagctatggttccacacaggcattcgaagaccccagagaacttcccagacgctggc
ttggagatgaactactgcaggaacccggatgatgacaagggcccttggtgctacaccact
gacccgagcgtcaggtgggagtactgcaacctgaagcggtgctcggagacaggagggagt
gttgcagaattgcccacagtttcccaagtaccaagtgggccgggcaactctgagacagac
tgcatgaacgggaatggcaaagactatcggggcaaaagggccgtcactgcagctggcacc
ccctgccagggatgggctgcccaggagccccacaggcacagcatcttcaccccacagaca
aacccacgggcgggtctggaaaagaactactgccgaaacccagatggggatgtgaatggt
ccttggtgctatacaacaaaccccagaaaactttatgactattgtgacatccccctgtgt
gcatcatcatcatcctttgagtgtgggaaacctcaggtggaaccgaagaaatgtcctggg
agggtggtgggtggctgcgtggccaaccctcactcctggccctggcaagtcagccttaga
acaaggtttaccggacagcacttctgtggaggtactttaatagccccagagtgggtgctg
actgctgcccactgtttggagaaatcttcgagacctgaattctacaaggttatcctgggt
gcgcacgaagaatatacccgcgggtcggacgttcaggaaatatcagtagccaaactgatc
ttggagcccaacaagcgtgacattgccctgctgaaactaagccgcccagccaccatcacg
aataaagtcattccagcttgtctgccacctccaaattatgtggttgctgatcggacaata
tgttacatcactggctggggagaaactcaagggactttcggtgccggccgtctcaaggag
gcccagctgcctgtgattgagaacaaggtgtgcaaccgcattgagtatctgaacaacaga
gtccaacccacagagctctgtgccggacatctggctggtggcgtcgacagctgccagggc
gacagtggaggacctctggtttgcttcgagaaggacaagtacattttacaaggagtcact
tcttggggtcttggctgtgctcgccccaataagcctggtgtctacgtgcgtgtctcacag
tttgttaattggatcgaaagggagatgaggaataactaa

DBGET integrated database retrieval system