Monomorium pharaonis (pharaoh ant): 105838445 Help Entry 105838445         CDS       T05760                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism mpha  Monomorium pharaonis (pharaoh ant) Pathway mpha00510   N-Glycan biosynthesis mpha00513   Various types of N-glycan biosynthesis mpha04141   Protein processing in endoplasmic reticulum Module mpha_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:mpha00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     105838445    00513 Various types of N-glycan biosynthesis     105838445  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105838445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 CAAD Motif Other DBs NCBI-GeneID:  105838445 NCBI-ProteinID:  XP_012539462 LinkDB All DBs Position 1:complement(560903..561618) Genome browser AA seq 80 aa AA seqDB search MVEIESMTRYVSPVNPAVFPLLAVVLLGIGVFFTAWFFVYEVTSTKFTRDICKEALISLV AALFSSFGVLFLLLWVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggtggaaatcgagtcgatgacgagatacgtctcgccagtgaacccagctgtctttccc ctgctggctgttgtgctgctaggtatcggagtgttcttcacggcctggttcttcgtgtac gaggtcaccagcactaaattcacgcgagatatatgcaaagaggcgttaatctccctggtt gcggccttgttctctagctttggagtactattcctgctgctctgggttgggatatacgta tag

DBGET integrated database retrieval system