Mycolicibacterium poriferae: MPOR_00220 Help Entry MPOR_00220        CDS       T07158                                  Name (GenBank) hypothetical protein   KO K01495   GTP cyclohydrolase IA [EC:3.5.4.16] Organism mpof  Mycolicibacterium poriferae Pathway mpof00790   Folate biosynthesis mpof01100   Metabolic pathways mpof01240   Biosynthesis of cofactors Module mpof_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:mpof00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     MPOR_00220 Enzymes [BR:mpof01000]  3. Hydrolases   3.5  Acting on carbon-nitrogen bonds, other than peptide bonds    3.5.4  In cyclic amidines     3.5.4.16  GTP cyclohydrolase I      MPOR_00220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GTP_cyclohydroI Motif Other DBs NCBI-ProteinID:  BBX48996 UniProt:  A0A6N4V0Q7 LinkDB All DBs Position complement(13688..13933) Genome browser AA seq 81 aa AA seqDB search MVDLYAKRPQVQERLTGQIADALMRKLDPRGAIVVVEAEHLCMAMRGIRKPGAVTTTSAV RGQFKTDNASRSEALDLILRK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt gtggtggatctctacgccaaacgcccgcaggtgcaggagcggttgaccggccagatcgcc gacgcgttgatgcgcaaactggacccccgcggggccatcgtggtggtcgaggccgagcat ctgtgcatggcgatgcgaggaatccgcaagcccggcgcggtgaccacgacgtcggccgtg cgcgggcagttcaagaccgacaacgcgtcgcgctccgaagccctggatctgatcttgaga aagtga

DBGET integrated database retrieval system