Methanohalophilus portucalensis: BKM01_04770 Help Entry BKM01_04770       CDS       T09768                                  Name (GenBank) ketoisovalerate oxidoreductase   KO K00188   2-oxoisovalerate ferredoxin oxidoreductase delta subunit [EC:1.2.7.7] Organism mpot  Methanohalophilus portucalensis Pathway mpot00280   Valine, leucine and isoleucine degradation mpot01100   Metabolic pathways mpot01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:mpot00001]  09100 Metabolism   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     BKM01_04770 Enzymes [BR:mpot01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)      BKM01_04770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_10 Fer4_9 Fer4_21 Fer4_22 Fer4_2 Fer4_6 Fer4_16 Fer4_8 Fer4_4 Fer4 Fer4_15 Fer4_3 Fer4_13 Fer4_17 Motif Other DBs NCBI-ProteinID:  ATU08145 UniProt:  A0A2D3C600 LinkDB All DBs Position complement(908964..909203) Genome browser AA seq 79 aa AA seqDB search MKEEKAEPYPLINVIECKGCARCITACPKNVLEMSDELNRRGYHYAQYKGQGCTGCANCY YTCPEPLAIEIHIPAKKRC NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaaggaagaaaaagcagaaccatatcctctaatcaatgttatagaatgcaaaggctgt gccagatgcattactgcctgtccaaaaaacgtgctggaaatgagtgatgaactcaacaga agaggttaccattatgcccagtataaaggtcaagggtgtaccggttgtgctaattgttat tacacatgcccggagcctcttgcaatagaaatacatatccctgctaaaaagaggtgttaa

DBGET integrated database retrieval system