Micromonas pusilla: MICPUCDRAFT_25062 Help Entry MICPUCDRAFT_25062 CDS       T02696                                  Name (RefSeq) uncharacterized protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism mpp  Micromonas pusilla Pathway mpp03420   Nucleotide excision repair mpp04120   Ubiquitin mediated proteolysis mpp04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mpp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     MICPUCDRAFT_25062    04120 Ubiquitin mediated proteolysis     MICPUCDRAFT_25062   09124 Replication and repair    03420 Nucleotide excision repair     MICPUCDRAFT_25062  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mpp04121]     MICPUCDRAFT_25062    03400 DNA repair and recombination proteins [BR:mpp03400]     MICPUCDRAFT_25062 Enzymes [BR:mpp01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      MICPUCDRAFT_25062 Ubiquitin system [BR:mpp04121]  Ubiquitin ligases (E3)   UBL E3 ligases    MICPUCDRAFT_25062   Multi subunit type E3    SCF complex     Ring finger protein      MICPUCDRAFT_25062    Cul2 complex      MICPUCDRAFT_25062    Cul3 complex      MICPUCDRAFT_25062    Cul4 complex      MICPUCDRAFT_25062    Cul7 complex      MICPUCDRAFT_25062    Cul8 complex      MICPUCDRAFT_25062    Cul9 complex      MICPUCDRAFT_25062 DNA repair and recombination proteins [BR:mpp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       MICPUCDRAFT_25062     TCR (transcription coupled repair) factors      Cul4-CSA complex       MICPUCDRAFT_25062 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-ANAPC11 zf-C3HC4 zf-RING_UBOX zf-RING_5 zf-C3HC4_3 zf-RING_16 zf-C3HC4_4 zf-RING-like PHD_NSD zf-Nse zf-RING_11 Prok-RING_4 zf-RING_10 zf-RING_6 Rtf2 zinc_ribbon_16 GBBH-like_N zf-RING_Vps41 TerY_C zf_RING_Vps8 Zf_2nd_IFT121 zf-C3H2C3 RINGv Motif Other DBs NCBI-GeneID:  9681998 NCBI-ProteinID:  XP_003056486 JGI:  25062 UniProt:  C1ML27 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MEKLSSRTRFEVKKWNAVAVWSWSICTDTCAICRNSLHEPSIEYQANPSSASEEGLSIAW GNCGHVFHLDCISKWLRTRSNCPLCNKEWEFAKIEKIQLPVMGLE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggagaaattgtcgtcgagaacacgatttgaagttaaaaagtggaatgctgtagcagtt tggtcatggtctatatgcacggacacgtgtgccatttgccgcaatagtttgcatgagcca agcatcgagtatcaagcaaacccctcttcggcatcagaagagggtcttagtattgcttgg gggaattgtggccatgtgtttcaccttgattgcatttccaagtggctcaggactcgcagt aactgtcccctatgtaacaaagaatgggaatttgccaagatagagaagatacagcttcct gtgatgggtcttgaatag

DBGET integrated database retrieval system