Moniliophthora perniciosa: MPER_14522 Help Entry MPER_14522        CDS       T01089                                  Name (GenBank) hypothetical protein   KO K12343   3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22] Organism mpr  Moniliophthora perniciosa Pathway mpr01100   Metabolic pathways Brite Enzymes [BR:mpr01000]  1. Oxidoreductases   1.3  Acting on the CH-CH group of donors    1.3.1  With NAD+ or NADP+ as acceptor     1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)      MPER_14522 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Steroid_dh Motif Other DBs NCBI-ProteinID:  EEB87918 LinkDB All DBs AA seq 65 aa AA seqDB search NDANTWSNPVWYIGLALWGVGFVGNVVHDEILLNIRRKFKKSGKKKDEQGGEHYGIPNGL LYTYV NT seq 196 nt NT seq  +upstreamnt  +downstreamnt gcaatgatgccaatacatggtctaacccagtgtggtacatcggcctcgcattgtggggag tcggattcgttgggaacgtggtacacgacgagattttgctaaacatcaggcgcaagttta agaagagcggaaagaagaaggacgagcaggggggagaacactacggcattccaaatggcc tcctttacacatacgt

DBGET integrated database retrieval system