Mustela putorius furo (domestic ferret): 101671648 Help Entry 101671648         CDS       T07239                                  Symbol IKBKG Name (RefSeq) NF-kappa-B essential modulator   KO K07210   inhibitor of nuclear factor kappa-B kinase subunit gamma Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf01523   Antifolate resistance mpuf04010   MAPK signaling pathway mpuf04014   Ras signaling pathway mpuf04062   Chemokine signaling pathway mpuf04064   NF-kappa B signaling pathway mpuf04151   PI3K-Akt signaling pathway mpuf04210   Apoptosis mpuf04380   Osteoclast differentiation mpuf04620   Toll-like receptor signaling pathway mpuf04621   NOD-like receptor signaling pathway mpuf04622   RIG-I-like receptor signaling pathway mpuf04623   Cytosolic DNA-sensing pathway mpuf04625   C-type lectin receptor signaling pathway mpuf04657   IL-17 signaling pathway mpuf04658   Th1 and Th2 cell differentiation mpuf04659   Th17 cell differentiation mpuf04660   T cell receptor signaling pathway mpuf04662   B cell receptor signaling pathway mpuf04668   TNF signaling pathway mpuf04920   Adipocytokine signaling pathway mpuf04936   Alcoholic liver disease mpuf05010   Alzheimer disease mpuf05132   Salmonella infection mpuf05135   Yersinia infection mpuf05142   Chagas disease mpuf05145   Toxoplasmosis mpuf05160   Hepatitis C mpuf05161   Hepatitis B mpuf05162   Measles mpuf05163   Human cytomegalovirus infection mpuf05164   Influenza A mpuf05165   Human papillomavirus infection mpuf05166   Human T-cell leukemia virus 1 infection mpuf05167   Kaposi sarcoma-associated herpesvirus infection mpuf05168   Herpes simplex virus 1 infection mpuf05169   Epstein-Barr virus infection mpuf05170   Human immunodeficiency virus 1 infection mpuf05171   Coronavirus disease - COVID-19 mpuf05200   Pathways in cancer mpuf05203   Viral carcinogenesis mpuf05208   Chemical carcinogenesis - reactive oxygen species mpuf05212   Pancreatic cancer mpuf05215   Prostate cancer mpuf05220   Chronic myeloid leukemia mpuf05221   Acute myeloid leukemia mpuf05222   Small cell lung cancer mpuf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mpuf05340   Primary immunodeficiency mpuf05417   Lipid and atherosclerosis mpuf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101671648 (IKBKG)    04014 Ras signaling pathway     101671648 (IKBKG)    04064 NF-kappa B signaling pathway     101671648 (IKBKG)    04668 TNF signaling pathway     101671648 (IKBKG)    04151 PI3K-Akt signaling pathway     101671648 (IKBKG)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101671648 (IKBKG)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101671648 (IKBKG)    04621 NOD-like receptor signaling pathway     101671648 (IKBKG)    04622 RIG-I-like receptor signaling pathway     101671648 (IKBKG)    04623 Cytosolic DNA-sensing pathway     101671648 (IKBKG)    04625 C-type lectin receptor signaling pathway     101671648 (IKBKG)    04660 T cell receptor signaling pathway     101671648 (IKBKG)    04658 Th1 and Th2 cell differentiation     101671648 (IKBKG)    04659 Th17 cell differentiation     101671648 (IKBKG)    04657 IL-17 signaling pathway     101671648 (IKBKG)    04662 B cell receptor signaling pathway     101671648 (IKBKG)    04062 Chemokine signaling pathway     101671648 (IKBKG)   09152 Endocrine system    04920 Adipocytokine signaling pathway     101671648 (IKBKG)   09158 Development and regeneration    04380 Osteoclast differentiation     101671648 (IKBKG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101671648 (IKBKG)    05208 Chemical carcinogenesis - reactive oxygen species     101671648 (IKBKG)    05203 Viral carcinogenesis     101671648 (IKBKG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101671648 (IKBKG)   09162 Cancer: specific types    05212 Pancreatic cancer     101671648 (IKBKG)    05221 Acute myeloid leukemia     101671648 (IKBKG)    05220 Chronic myeloid leukemia     101671648 (IKBKG)    05215 Prostate cancer     101671648 (IKBKG)    05222 Small cell lung cancer     101671648 (IKBKG)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101671648 (IKBKG)    05170 Human immunodeficiency virus 1 infection     101671648 (IKBKG)    05161 Hepatitis B     101671648 (IKBKG)    05160 Hepatitis C     101671648 (IKBKG)    05171 Coronavirus disease - COVID-19     101671648 (IKBKG)    05164 Influenza A     101671648 (IKBKG)    05162 Measles     101671648 (IKBKG)    05168 Herpes simplex virus 1 infection     101671648 (IKBKG)    05163 Human cytomegalovirus infection     101671648 (IKBKG)    05167 Kaposi sarcoma-associated herpesvirus infection     101671648 (IKBKG)    05169 Epstein-Barr virus infection     101671648 (IKBKG)    05165 Human papillomavirus infection     101671648 (IKBKG)   09171 Infectious disease: bacterial    05132 Salmonella infection     101671648 (IKBKG)    05135 Yersinia infection     101671648 (IKBKG)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101671648 (IKBKG)    05142 Chagas disease     101671648 (IKBKG)   09163 Immune disease    05340 Primary immunodeficiency     101671648 (IKBKG)   09164 Neurodegenerative disease    05010 Alzheimer disease     101671648 (IKBKG)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101671648 (IKBKG)    05418 Fluid shear stress and atherosclerosis     101671648 (IKBKG)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101671648 (IKBKG)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     101671648 (IKBKG)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mpuf01001]     101671648 (IKBKG) Protein kinases [BR:mpuf01001]  Serine/threonine kinases: Other   IKK family [OT]    101671648 (IKBKG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CC2-LZ NEMO zf_C2H2_10 ZapB Filament LLC1 Motif Other DBs NCBI-GeneID:  101671648 NCBI-ProteinID:  XP_012905560 Ensembl:  ENSMPUG00000009835 UniProt:  M3YEK4 LinkDB All DBs Position Unknown AA seq 412 aa AA seqDB search MSRPPWKSPPCEMVQPSGGPTGDQDVLGEESSLGKPAMLHVTSEQGTPETFQRCLEENQE LRDAIRQSNQVLRERCEELQRFQGSQRKEKEFLVQKFQEARKLVERLSLEKRELRRQTEQ ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAANKERQALEGRARAASEQ AQQLESERAALQQQHSVQVDQLRMQSQSVEAALRMERQAASEDKRKLAQLQVAYHQLFQE YDSHVKSSTGMQLEDLKQQLQQAEEALAAKQEVIDKLKEEAEQHKAVMETVPVLKAQADI YKADFQAERQAREKLAERKELLQEQLEQLQREYSRLKASCQESARIEDLRKRHVEVSQAP LPPSPAHPSFHLALPSQRRSPPEEPPDFCCPKCQYRAPDMDTLQIHVMECIE NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt atgagcaggcccccctggaagagtccaccgtgtgagatggtgcagcccagtggcggcccg acaggggaccaggacgtgctgggtgaagagtcttctctggggaagccggccatgctccac gtcacttctgagcagggcactcccgagaccttccagcgctgcctggaggagaatcaagag ctccgagacgccatccgccagagcaaccaggtgctgcgcgagcgctgtgaggagctgcag cgcttccagggcagccagaggaaggagaaggagttcctcgtgcagaagttccaggaagcc cggaagctggtggagagactgagcctggagaagcgcgagctgcggaggcagacggagcag gccctgcaggaggtggagcacctgaagcgctgccagcagcagatggccgaggacaaggcc tccgtgaaagcccaggtgacatccttgctgggggagctccaggagagccagagtcgtttg gaggccgccaacaaggagcggcaggctttggagggcagggcccgggcggccagtgagcag gcgcagcagctggagagcgagcgggcggcgctgcagcagcagcacagcgtgcaggtggac cagctgcggatgcagagccagagcgtggaggcggccctgcgcatggagcgccaagcagcc tcggaggataagcggaagctggcccagctgcaggtggcctatcaccagctcttccaggag tacgacagccatgtcaagagcagcacgggaatgcagctggaggacctcaagcagcagctc cagcaggcggaggaggccctggcggccaagcaggaagtgatcgacaaactgaaggaggag gccgagcagcacaaggccgtgatggagacggtccctgtgctaaaggcgcaggcggatatc tacaaggccgacttccaggctgagaggcaggcgcgggagaagctggcagagaggaaggag ctcctgcaggagcagctggagcagctgcagagggagtacagcaggctgaaggccagctgc caggagtcggccaggatcgaagacctgaggaagcgacacgtggaggtctcccaggccccc ttgccccccagcccagctcacccctccttccacctggccttgcccagccagaggagaagc ccccccgaggagccgcctgacttctgttgccccaagtgccagtaccgggctccggatatg gacacgctgcagatccacgtcatggagtgcattgagtag

DBGET integrated database retrieval system