Mustela putorius furo (domestic ferret): 101677794 Help Entry 101677794         CDS       T07239                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf01522   Endocrine resistance mpuf01524   Platinum drug resistance mpuf04010   MAPK signaling pathway mpuf04071   Sphingolipid signaling pathway mpuf04110   Cell cycle mpuf04115   p53 signaling pathway mpuf04137   Mitophagy - animal mpuf04151   PI3K-Akt signaling pathway mpuf04210   Apoptosis mpuf04211   Longevity regulating pathway mpuf04216   Ferroptosis mpuf04218   Cellular senescence mpuf04310   Wnt signaling pathway mpuf04722   Neurotrophin signaling pathway mpuf04919   Thyroid hormone signaling pathway mpuf05012   Parkinson disease mpuf05014   Amyotrophic lateral sclerosis mpuf05016   Huntington disease mpuf05160   Hepatitis C mpuf05161   Hepatitis B mpuf05162   Measles mpuf05163   Human cytomegalovirus infection mpuf05165   Human papillomavirus infection mpuf05166   Human T-cell leukemia virus 1 infection mpuf05167   Kaposi sarcoma-associated herpesvirus infection mpuf05168   Herpes simplex virus 1 infection mpuf05169   Epstein-Barr virus infection mpuf05200   Pathways in cancer mpuf05202   Transcriptional misregulation in cancer mpuf05203   Viral carcinogenesis mpuf05205   Proteoglycans in cancer mpuf05206   MicroRNAs in cancer mpuf05210   Colorectal cancer mpuf05212   Pancreatic cancer mpuf05213   Endometrial cancer mpuf05214   Glioma mpuf05215   Prostate cancer mpuf05216   Thyroid cancer mpuf05217   Basal cell carcinoma mpuf05218   Melanoma mpuf05219   Bladder cancer mpuf05220   Chronic myeloid leukemia mpuf05222   Small cell lung cancer mpuf05223   Non-small cell lung cancer mpuf05224   Breast cancer mpuf05225   Hepatocellular carcinoma mpuf05226   Gastric cancer mpuf05230   Central carbon metabolism in cancer mpuf05417   Lipid and atherosclerosis mpuf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101677794 (TP53)    04310 Wnt signaling pathway     101677794 (TP53)    04071 Sphingolipid signaling pathway     101677794 (TP53)    04151 PI3K-Akt signaling pathway     101677794 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     101677794 (TP53)   09143 Cell growth and death    04110 Cell cycle     101677794 (TP53)    04210 Apoptosis     101677794 (TP53)    04216 Ferroptosis     101677794 (TP53)    04115 p53 signaling pathway     101677794 (TP53)    04218 Cellular senescence     101677794 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     101677794 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     101677794 (TP53)   09149 Aging    04211 Longevity regulating pathway     101677794 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101677794 (TP53)    05202 Transcriptional misregulation in cancer     101677794 (TP53)    05206 MicroRNAs in cancer     101677794 (TP53)    05205 Proteoglycans in cancer     101677794 (TP53)    05203 Viral carcinogenesis     101677794 (TP53)    05230 Central carbon metabolism in cancer     101677794 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     101677794 (TP53)    05212 Pancreatic cancer     101677794 (TP53)    05225 Hepatocellular carcinoma     101677794 (TP53)    05226 Gastric cancer     101677794 (TP53)    05214 Glioma     101677794 (TP53)    05216 Thyroid cancer     101677794 (TP53)    05220 Chronic myeloid leukemia     101677794 (TP53)    05217 Basal cell carcinoma     101677794 (TP53)    05218 Melanoma     101677794 (TP53)    05219 Bladder cancer     101677794 (TP53)    05215 Prostate cancer     101677794 (TP53)    05213 Endometrial cancer     101677794 (TP53)    05224 Breast cancer     101677794 (TP53)    05222 Small cell lung cancer     101677794 (TP53)    05223 Non-small cell lung cancer     101677794 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101677794 (TP53)    05161 Hepatitis B     101677794 (TP53)    05160 Hepatitis C     101677794 (TP53)    05162 Measles     101677794 (TP53)    05168 Herpes simplex virus 1 infection     101677794 (TP53)    05163 Human cytomegalovirus infection     101677794 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     101677794 (TP53)    05169 Epstein-Barr virus infection     101677794 (TP53)    05165 Human papillomavirus infection     101677794 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     101677794 (TP53)    05014 Amyotrophic lateral sclerosis     101677794 (TP53)    05016 Huntington disease     101677794 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101677794 (TP53)    05418 Fluid shear stress and atherosclerosis     101677794 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     101677794 (TP53)    01522 Endocrine resistance     101677794 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mpuf03000]     101677794 (TP53)    03036 Chromosome and associated proteins [BR:mpuf03036]     101677794 (TP53)    03400 DNA repair and recombination proteins [BR:mpuf03400]     101677794 (TP53) Transcription factors [BR:mpuf03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     101677794 (TP53) Chromosome and associated proteins [BR:mpuf03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      101677794 (TP53) DNA repair and recombination proteins [BR:mpuf03400]  Eukaryotic type   Check point factors    Other check point factors     101677794 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  101677794 NCBI-ProteinID:  XP_004760313 Ensembl:  ENSMPUG00000009017 UniProt:  M3YC88 LinkDB All DBs Position Unknown AA seq 375 aa AA seqDB search MQDPQSELTIDPPLSQETFSELWNLLPENNVLSPAVDELLSEGVNWLGEGSNDAPRMPAT PAPAAPGPAPSWPLSSFVPSPKTYPGTYGFRLGFLHSGTAKSVTCTYSPSLNKLFCQLAK TCPVQLWVSSPPPADTCVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAPPQHLIRVE GNLRAKYLDDRNTFRQSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLE DSSGNVLGRSSFEVRVCACPGRDRRTEEENFRKKGEPCPEPPPGSTKRALPPSTSSSPPQ KKKPLDGEYFTLQIRGLERYNMFRELNEALELKDALNGKEPGGSRPHSSHLKAKKGQSTS RHKKPMLKREGPDSD NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atgcaggacccacagtccgagctcaccatcgacccccctttaagccaggagacattttcc gaattgtggaacctgcttcctgaaaacaatgttctgtcccctgcagtggatgaactgctg tcagaaggcgtgaactggctgggagaagggtccaatgacgctcccaggatgccggcgact cctgcgcccgcagcgcccggacccgccccctcctggcccctgtcatcttttgtcccttcc ccgaagacctaccctggcacctatgggttccgtctggggttcctgcattctgggacagcc aagtctgttacttgcacgtactccccctccctcaacaagctgttctgccagctggcaaag acctgccccgtgcagctgtgggtcagctcgccacccccagccgacacctgcgtccgggcc atggccatttacaagaagtcggagtttgtgacggaagtggtgcggcgctgcccccaccat gagcgctgctcggacagtagtgatggtctggccccgcctcagcatctcatccgggtagag ggaaacctgcgggccaagtacctggacgataggaacaccttccggcagagcgtggtggtg ccctacgagccgcccgaggtgggctccgactgcaccaccatccactataactacatgtgt aacagttcctgcatggggggcatgaaccgccggcccatcctcaccatcatcactctggaa gattccagtggtaatgtgctgggacggagcagcttcgaggtacgcgtctgtgcctgtcct gggagagaccggcgcacagaggaggaaaatttccgcaagaagggggagccttgccccgag ccgccccccgggagcaccaagcgagcactgcctcccagcaccagctcgtctcccccgcaa aagaagaagccgctggatggggagtacttcacccttcagatccgtggccttgaacgctac aacatgttcagggagttgaatgaggccttggagctgaaggatgccctgaatggaaaggag ccagggggaagcaggcctcactccagccacctgaaggctaagaaggggcagtctacctcc cgccataaaaaaccaatgctgaagagagaggggcccgactcagactga

DBGET integrated database retrieval system