Mustela putorius furo (domestic ferret): 101679100 Help Entry 101679100         CDS       T07239                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04060   Cytokine-cytokine receptor interaction mpuf04151   PI3K-Akt signaling pathway mpuf04217   Necroptosis mpuf04380   Osteoclast differentiation mpuf04620   Toll-like receptor signaling pathway mpuf04621   NOD-like receptor signaling pathway mpuf04622   RIG-I-like receptor signaling pathway mpuf04623   Cytosolic DNA-sensing pathway mpuf04630   JAK-STAT signaling pathway mpuf04650   Natural killer cell mediated cytotoxicity mpuf04668   TNF signaling pathway mpuf04936   Alcoholic liver disease mpuf05135   Yersinia infection mpuf05142   Chagas disease mpuf05152   Tuberculosis mpuf05160   Hepatitis C mpuf05161   Hepatitis B mpuf05162   Measles mpuf05163   Human cytomegalovirus infection mpuf05164   Influenza A mpuf05165   Human papillomavirus infection mpuf05167   Kaposi sarcoma-associated herpesvirus infection mpuf05168   Herpes simplex virus 1 infection mpuf05169   Epstein-Barr virus infection mpuf05170   Human immunodeficiency virus 1 infection mpuf05171   Coronavirus disease mpuf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101679100 (IFNB1)    04668 TNF signaling pathway     101679100 (IFNB1)    04151 PI3K-Akt signaling pathway     101679100 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101679100 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101679100 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101679100 (IFNB1)    04621 NOD-like receptor signaling pathway     101679100 (IFNB1)    04622 RIG-I-like receptor signaling pathway     101679100 (IFNB1)    04623 Cytosolic DNA-sensing pathway     101679100 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     101679100 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     101679100 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101679100 (IFNB1)    05161 Hepatitis B     101679100 (IFNB1)    05160 Hepatitis C     101679100 (IFNB1)    05171 Coronavirus disease     101679100 (IFNB1)    05164 Influenza A     101679100 (IFNB1)    05162 Measles     101679100 (IFNB1)    05168 Herpes simplex virus 1 infection     101679100 (IFNB1)    05163 Human cytomegalovirus infection     101679100 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     101679100 (IFNB1)    05169 Epstein-Barr virus infection     101679100 (IFNB1)    05165 Human papillomavirus infection     101679100 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     101679100 (IFNB1)    05152 Tuberculosis     101679100 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     101679100 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101679100 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101679100 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpuf04052]     101679100 (IFNB1) Cytokines and neuropeptides [BR:mpuf04052]  Cytokines   Interferons    101679100 (IFNB1) SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  101679100 NCBI-ProteinID:  XP_004761877 Ensembl:  ENSMPUG00000019528 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MTSRCILQTALLVYFSTTVLAMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFK IPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLE EILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKL TDSLPN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccagcaggtgtatcctccaaactgctctcctggtatatttctccaccacggttctt gccatgaactataacttacttcgattccaactaagcagcagcagtgtggagtgccaggag ctccttctacagttgaatggaacatctaaagattgcctcaaggacaggatgaacttcaag atccctgaggagatccagaaatcccagaagttccagaaggaggacatcgtattggtcacc cttgagatgttccaaaagacttctgatattttcaggagaaatctctcaagcacgggatgg aatgagagcattgtcgagaacctccttgccacactccactggcagaaggaacatctggag gaaatcctggaggacatcatgcaggaggaaaacgtcacttgggaccacaggacccttctg cacctgaagagatattatctaaggattgtgcggtacctgaaagcgaaggagttcagcgtc tgtgcctggacaatagtgcaagcagaaatcctcaggagctttttcttccttgataaactt acagattctctccctaactga

DBGET integrated database retrieval system