Mustela putorius furo (domestic ferret): 101682511 Help Entry 101682511         CDS       T07239                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf03083   Polycomb repressive complex mpuf04010   MAPK signaling pathway mpuf05200   Pathways in cancer mpuf05202   Transcriptional misregulation in cancer mpuf05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:mpuf00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     101682511 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101682511 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101682511 (MAX)    05202 Transcriptional misregulation in cancer     101682511 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     101682511 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mpuf03000]     101682511 (MAX)    03036 Chromosome and associated proteins [BR:mpuf03036]     101682511 (MAX) Transcription factors [BR:mpuf03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     101682511 (MAX) Chromosome and associated proteins [BR:mpuf03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      101682511 (MAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH JetA Filament bZIP_2 bHLH_INO4 SlyX bHLH_INO2 SLX9 GAGA_bind DUF7801 DUF4763 XhlA Csm1_N ATG16 Motif Other DBs NCBI-GeneID:  101682511 NCBI-ProteinID:  XP_004738999 Ensembl:  ENSMPUG00000006859 UniProt:  M3Y654 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgatgacctcaagcggcagaatgctctcctggagcagcaagtccgt gcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcagcaccatctctgccttcgatggaggctcggactcc agctcggagtcggagcccgaagagccccaaagcaggaagaagctccggatggaggccagc taa

DBGET integrated database retrieval system