Mustela putorius furo (domestic ferret): 101685236 Help Entry 101685236         CDS       T07239                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf01522   Endocrine resistance mpuf04010   MAPK signaling pathway mpuf04024   cAMP signaling pathway mpuf04210   Apoptosis mpuf04380   Osteoclast differentiation mpuf04620   Toll-like receptor signaling pathway mpuf04657   IL-17 signaling pathway mpuf04658   Th1 and Th2 cell differentiation mpuf04659   Th17 cell differentiation mpuf04660   T cell receptor signaling pathway mpuf04662   B cell receptor signaling pathway mpuf04668   TNF signaling pathway mpuf04713   Circadian entrainment mpuf04725   Cholinergic synapse mpuf04728   Dopaminergic synapse mpuf04915   Estrogen signaling pathway mpuf04917   Prolactin signaling pathway mpuf04921   Oxytocin signaling pathway mpuf04926   Relaxin signaling pathway mpuf04928   Parathyroid hormone synthesis, secretion and action mpuf04932   Non-alcoholic fatty liver disease mpuf04935   Growth hormone synthesis, secretion and action mpuf05031   Amphetamine addiction mpuf05132   Salmonella infection mpuf05133   Pertussis mpuf05135   Yersinia infection mpuf05140   Leishmaniasis mpuf05142   Chagas disease mpuf05161   Hepatitis B mpuf05162   Measles mpuf05166   Human T-cell leukemia virus 1 infection mpuf05167   Kaposi sarcoma-associated herpesvirus infection mpuf05170   Human immunodeficiency virus 1 infection mpuf05171   Coronavirus disease - COVID-19 mpuf05200   Pathways in cancer mpuf05207   Chemical carcinogenesis - receptor activation mpuf05208   Chemical carcinogenesis - reactive oxygen species mpuf05210   Colorectal cancer mpuf05224   Breast cancer mpuf05231   Choline metabolism in cancer mpuf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mpuf05323   Rheumatoid arthritis mpuf05417   Lipid and atherosclerosis mpuf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101685236 (FOS)    04668 TNF signaling pathway     101685236 (FOS)    04024 cAMP signaling pathway     101685236 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101685236 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101685236 (FOS)    04660 T cell receptor signaling pathway     101685236 (FOS)    04658 Th1 and Th2 cell differentiation     101685236 (FOS)    04659 Th17 cell differentiation     101685236 (FOS)    04657 IL-17 signaling pathway     101685236 (FOS)    04662 B cell receptor signaling pathway     101685236 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     101685236 (FOS)    04917 Prolactin signaling pathway     101685236 (FOS)    04921 Oxytocin signaling pathway     101685236 (FOS)    04926 Relaxin signaling pathway     101685236 (FOS)    04935 Growth hormone synthesis, secretion and action     101685236 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     101685236 (FOS)   09156 Nervous system    04725 Cholinergic synapse     101685236 (FOS)    04728 Dopaminergic synapse     101685236 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     101685236 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     101685236 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101685236 (FOS)    05207 Chemical carcinogenesis - receptor activation     101685236 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     101685236 (FOS)    05231 Choline metabolism in cancer     101685236 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101685236 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     101685236 (FOS)    05224 Breast cancer     101685236 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101685236 (FOS)    05170 Human immunodeficiency virus 1 infection     101685236 (FOS)    05161 Hepatitis B     101685236 (FOS)    05171 Coronavirus disease - COVID-19     101685236 (FOS)    05162 Measles     101685236 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     101685236 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     101685236 (FOS)    05135 Yersinia infection     101685236 (FOS)    05133 Pertussis     101685236 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101685236 (FOS)    05142 Chagas disease     101685236 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     101685236 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     101685236 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101685236 (FOS)    05418 Fluid shear stress and atherosclerosis     101685236 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101685236 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     101685236 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mpuf03000]     101685236 (FOS)    04131 Membrane trafficking [BR:mpuf04131]     101685236 (FOS) Transcription factors [BR:mpuf03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     101685236 (FOS) Membrane trafficking [BR:mpuf04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     101685236 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  101685236 NCBI-ProteinID:  XP_004739291 Ensembl:  ENSMPUG00000009153 UniProt:  M1EMS4 LinkDB All DBs Position Unknown AA seq 381 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEAATPESDEAFT LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETTARSVPDMDLSGSFY AADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPDADSFPSCAAAHR KGSSSNEPSSDSLSSPTLLAL NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacaacctctcctactaccactcaccggccgactccttctccagcatg ggctcgcccgtcaatgcgcaggacttctgcacggatctggcggtctccagtgccaacttt atcccgacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggccccatcccagaccagagccccccatccctatggagtcccgacc ccctctgctggggcttactccagggctggagtcgtgaagaccatgacgggaggcagagct cagagcatcggccggaggggcaaggtggaacagttgtccccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggccgcagccaagtgccggaaccgaaggagggag ctgacggacacactccaagcggaaacagaccaactggaagatgaaaagtctgctttgcag accgagattgccaacctgctgaaggagaaggagaagctagagttcatcctggcagctcac cgacctgcctgcaagatccccgatgacctgggcttccccgaagagatgtctgtggcttcc ctcgatctgaccgggggcctgcccgaagctgccacccccgagtcggatgaggccttcacc ctgcccctcctcaatgatcccgagccaaagccctccgttgagccagtcaagagcatcagt agcatggagctcaaggccgagccctttgatgacttcctgttcccagcatcatccaggccc agtggctctgagaccaccgcccgctctgtgccagacatggacctgtctggttccttctat gcagcagactgggagcccctgcacggtggctccctggggatggggcccatggccacagag ctggagcccctgtgcacccccgtggtcacctgtactcccagctgcactacctacacgtct tccttcgtcttcacctaccccgacgctgactccttccccagctgtgcggctgctcaccgc aagggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacactgctggcc ctgtga

DBGET integrated database retrieval system