Mustela putorius furo (domestic ferret): 101686417 Help Entry 101686417         CDS       T07239                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04060   Cytokine-cytokine receptor interaction mpuf04151   PI3K-Akt signaling pathway mpuf04630   JAK-STAT signaling pathway mpuf04640   Hematopoietic cell lineage mpuf04657   IL-17 signaling pathway mpuf04658   Th1 and Th2 cell differentiation mpuf04659   Th17 cell differentiation mpuf04660   T cell receptor signaling pathway mpuf04664   Fc epsilon RI signaling pathway mpuf04672   Intestinal immune network for IgA production mpuf05140   Leishmaniasis mpuf05200   Pathways in cancer mpuf05310   Asthma mpuf05320   Autoimmune thyroid disease mpuf05321   Inflammatory bowel disease mpuf05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101686417 (IL4)    04151 PI3K-Akt signaling pathway     101686417 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101686417 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101686417 (IL4)    04660 T cell receptor signaling pathway     101686417 (IL4)    04658 Th1 and Th2 cell differentiation     101686417 (IL4)    04659 Th17 cell differentiation     101686417 (IL4)    04657 IL-17 signaling pathway     101686417 (IL4)    04664 Fc epsilon RI signaling pathway     101686417 (IL4)    04672 Intestinal immune network for IgA production     101686417 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101686417 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101686417 (IL4)   09163 Immune disease    05310 Asthma     101686417 (IL4)    05320 Autoimmune thyroid disease     101686417 (IL4)    05321 Inflammatory bowel disease     101686417 (IL4)    05330 Allograft rejection     101686417 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpuf04052]     101686417 (IL4)    00536 Glycosaminoglycan binding proteins [BR:mpuf00536]     101686417 (IL4) Cytokines and neuropeptides [BR:mpuf04052]  Cytokines   Interleukins    101686417 (IL4) Glycosaminoglycan binding proteins [BR:mpuf00536]  Heparan sulfate / Heparin   Cytokines    101686417 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 DUF4381 Motif Other DBs NCBI-GeneID:  101686417 NCBI-ProteinID:  XP_004745062 Ensembl:  ENSMPUG00000010501 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MGLTSQLIPTLVCLLALTGTFIHGHNFSIAIKEIIKTLNILTARNDSCMELTVTEVFSAP KNTSEKEIFCRAATVLQQLSTHNCSNRLLRGLHRNLRNMANMTCSVNEVKKSTLKDFLER LKVIMQQKYYRH NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgattccaactctggtctgcttactagcactcaccggcact ttcatccacggacataacttcagtattgccattaaggagatcatcaaaacgttgaacatc ctcacagcgagaaacgactcatgcatggagctgaccgtcactgaagtcttctctgcccca aagaacacaagtgagaaggaaatcttctgcagagctgcaactgtgcttcagcagctctct acacacaattgctccaacagattgctcagaggacttcacaggaacctcaggaacatggca aacatgacctgttcggtgaatgaagtcaagaagagtacactgaaagacttcttggaaagg ctaaaagtgatcatgcaacagaaatactacaggcactga

DBGET integrated database retrieval system