Mustela putorius furo (domestic ferret): 101687674 Help Entry 101687674         CDS       T07239                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf03420   Nucleotide excision repair mpuf04066   HIF-1 signaling pathway mpuf04110   Cell cycle mpuf04114   Oocyte meiosis mpuf04120   Ubiquitin mediated proteolysis mpuf04141   Protein processing in endoplasmic reticulum mpuf04310   Wnt signaling pathway mpuf04350   TGF-beta signaling pathway mpuf04710   Circadian rhythm mpuf05170   Human immunodeficiency virus 1 infection mpuf05200   Pathways in cancer mpuf05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mpuf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101687674 (RBX1)    04120 Ubiquitin mediated proteolysis     101687674 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     101687674 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     101687674 (RBX1)    04350 TGF-beta signaling pathway     101687674 (RBX1)    04066 HIF-1 signaling pathway     101687674 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     101687674 (RBX1)    04114 Oocyte meiosis     101687674 (RBX1)  09150 Organismal Systems   09159 Environmental adaptation    04710 Circadian rhythm     101687674 (RBX1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101687674 (RBX1)   09162 Cancer: specific types    05211 Renal cell carcinoma     101687674 (RBX1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101687674 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mpuf04121]     101687674 (RBX1)    03400 DNA repair and recombination proteins [BR:mpuf03400]     101687674 (RBX1) Enzymes [BR:mpuf01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      101687674 (RBX1) Ubiquitin system [BR:mpuf04121]  Ubiquitin ligases (E3)   UBL E3 ligases    101687674 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      101687674 (RBX1)    Cul2 complex      101687674 (RBX1)    Cul3 complex      101687674 (RBX1)    Cul4 complex      101687674 (RBX1)    Cul7 complex      101687674 (RBX1)    Cul8 complex      101687674 (RBX1)    Cul9 complex      101687674 (RBX1) DNA repair and recombination proteins [BR:mpuf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       101687674 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       101687674 (RBX1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  101687674 NCBI-ProteinID:  XP_004771323 Ensembl:  ENSMPUG00000016430 UniProt:  M3YYB6 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat aactgtgccatctgcaggaaccacattatggatctttgcatagaatgtcaagctaaccag gcgtctgctacttctgaagagtgcactgttgcatggggagtctgtaaccatgcttttcac ttccactgcatctctcgctggctcaaaacacggcaggtgtgtccgttggacaacagagag tgggaattccaaaagtacgggcactag

DBGET integrated database retrieval system