Mustela putorius furo (domestic ferret): 101691404 Help Entry 101691404         CDS       T07239                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04010   MAPK signaling pathway mpuf04014   Ras signaling pathway mpuf04015   Rap1 signaling pathway mpuf04024   cAMP signaling pathway mpuf04062   Chemokine signaling pathway mpuf04510   Focal adhesion mpuf04517   IgSF CAM signaling mpuf04520   Adherens junction mpuf04611   Platelet activation mpuf04670   Leukocyte transendothelial migration mpuf04720   Long-term potentiation mpuf04722   Neurotrophin signaling pathway mpuf04934   Cushing syndrome mpuf04972   Pancreatic secretion mpuf05211   Renal cell carcinoma mpuf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101691404 (RAP1B)    04014 Ras signaling pathway     101691404 (RAP1B)    04015 Rap1 signaling pathway     101691404 (RAP1B)    04024 cAMP signaling pathway     101691404 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     101691404 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     101691404 (RAP1B)    04520 Adherens junction     101691404 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101691404 (RAP1B)    04670 Leukocyte transendothelial migration     101691404 (RAP1B)    04062 Chemokine signaling pathway     101691404 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     101691404 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     101691404 (RAP1B)    04722 Neurotrophin signaling pathway     101691404 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     101691404 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101691404 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     101691404 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpuf04147]     101691404 (RAP1B)    04031 GTP-binding proteins [BR:mpuf04031]     101691404 (RAP1B) Exosome [BR:mpuf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101691404 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    101691404 (RAP1B)   Exosomal proteins of colorectal cancer cells    101691404 (RAP1B) GTP-binding proteins [BR:mpuf04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     101691404 (RAP1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  101691404 NCBI-ProteinID:  XP_004752518 Ensembl:  ENSMPUG00000017508 UniProt:  M3Z1D5 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatacgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttactgcaatgagagatttatacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagagcagatt cttcgagttaaagacactgatgatgttccgatgatcctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcagaacctagcaagacagtggaacaac tgtgcgttcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system