Muntiacus reevesi (Reeves' muntjac): 136146144 Help Entry 136146144         CDS       T10466                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree01521   EGFR tyrosine kinase inhibitor resistance mree04010   MAPK signaling pathway mree04014   Ras signaling pathway mree04015   Rap1 signaling pathway mree04020   Calcium signaling pathway mree04151   PI3K-Akt signaling pathway mree04550   Signaling pathways regulating pluripotency of stem cells mree04810   Regulation of actin cytoskeleton mree05167   Kaposi sarcoma-associated herpesvirus infection mree05200   Pathways in cancer mree05205   Proteoglycans in cancer mree05207   Chemical carcinogenesis - receptor activation mree05218   Melanoma mree05224   Breast cancer mree05226   Gastric cancer Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136146144 (FGF2)    04014 Ras signaling pathway     136146144 (FGF2)    04015 Rap1 signaling pathway     136146144 (FGF2)    04020 Calcium signaling pathway     136146144 (FGF2)    04151 PI3K-Akt signaling pathway     136146144 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     136146144 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     136146144 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136146144 (FGF2)    05205 Proteoglycans in cancer     136146144 (FGF2)    05207 Chemical carcinogenesis - receptor activation     136146144 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     136146144 (FGF2)    05218 Melanoma     136146144 (FGF2)    05224 Breast cancer     136146144 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     136146144 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     136146144 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mree04052]     136146144 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:mree00536]     136146144 (FGF2) Cytokines and neuropeptides [BR:mree04052]  Cytokines   Growth factors (RTK binding)    136146144 (FGF2) Glycosaminoglycan binding proteins [BR:mree00536]  Heparan sulfate / Heparin   Growth factors/receptors    136146144 (FGF2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin IL1 Motif Other DBs NCBI-GeneID:  136146144 NCBI-ProteinID:  XP_065761141 LinkDB All DBs Position 13:37391892..37443738 Genome browser AA seq 155 aa AA seqDB search MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggccgccgggagcatcaccacgctgcccgccctgccggaggacggcggcagcggcgct ttcccgccgggccacttcaaggaccccaagcggctgtactgcaagaacgggggcttcttc ctgcgcatccaccccgacggccgagtggacggggtccgcgagaagagtgaccctcacatc aaactacaacttcaagcagaagagagaggggttgtgtctatcaaaggagtgtgtgcaaac cgttatcttgctatgaaagaagatggaagattattggcttcgaaatgtgttacagacgag tgtttcttttttgaacgattggagtctaataactacaatacttaccggtcgaggaaatac tccagttggtatgtggcactgaaacgaactgggcagtataaacttggacccaaaacagga cctgggcagaaagctatactttttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system