Muntiacus reevesi (Reeves' muntjac): 136148545 Help Entry 136148545         CDS       T10466                                  Name (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04060   Cytokine-cytokine receptor interaction mree04151   PI3K-Akt signaling pathway mree04217   Necroptosis mree04380   Osteoclast differentiation mree04620   Toll-like receptor signaling pathway mree04621   NOD-like receptor signaling pathway mree04622   RIG-I-like receptor signaling pathway mree04623   Cytosolic DNA-sensing pathway mree04630   JAK-STAT signaling pathway mree04650   Natural killer cell mediated cytotoxicity mree04668   TNF signaling pathway mree04936   Alcoholic liver disease mree05135   Yersinia infection mree05142   Chagas disease mree05152   Tuberculosis mree05160   Hepatitis C mree05161   Hepatitis B mree05162   Measles mree05163   Human cytomegalovirus infection mree05164   Influenza A mree05165   Human papillomavirus infection mree05167   Kaposi sarcoma-associated herpesvirus infection mree05168   Herpes simplex virus 1 infection mree05169   Epstein-Barr virus infection mree05170   Human immunodeficiency virus 1 infection mree05171   Coronavirus disease - COVID-19 mree05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     136148545    04668 TNF signaling pathway     136148545    04151 PI3K-Akt signaling pathway     136148545   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136148545  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     136148545  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     136148545    04621 NOD-like receptor signaling pathway     136148545    04622 RIG-I-like receptor signaling pathway     136148545    04623 Cytosolic DNA-sensing pathway     136148545    04650 Natural killer cell mediated cytotoxicity     136148545   09158 Development and regeneration    04380 Osteoclast differentiation     136148545  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     136148545    05161 Hepatitis B     136148545    05160 Hepatitis C     136148545    05171 Coronavirus disease - COVID-19     136148545    05164 Influenza A     136148545    05162 Measles     136148545    05168 Herpes simplex virus 1 infection     136148545    05163 Human cytomegalovirus infection     136148545    05167 Kaposi sarcoma-associated herpesvirus infection     136148545    05169 Epstein-Barr virus infection     136148545    05165 Human papillomavirus infection     136148545   09171 Infectious disease: bacterial    05135 Yersinia infection     136148545    05152 Tuberculosis     136148545   09174 Infectious disease: parasitic    05142 Chagas disease     136148545   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136148545   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     136148545  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mree04052]     136148545 Cytokines and neuropeptides [BR:mree04052]  Cytokines   Interferons    136148545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  136148545 NCBI-ProteinID:  XP_065764233 LinkDB All DBs Position 17:21860164..21863283 Genome browser AA seq 186 aa AA seqDB search MTYRCLQQMFLRLCFSTTALSMNYSLLRFEQRRSDMVCQKLLRQLPSTPQHCLEVRMDFQ VPEEMKQAQQFQKEDAVLVIYEMLQQIFGILTRDFSSTGWSETIIEYLLVELQGQMDHVG PIQKEIMRKKNFTTGDMTIPHLKKYYINLGQYLKSMEYNSSAWTVVRAEMFKNFSFLKSL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctccagcagatgtttctcaggctgtgtttctccaccacagctctc tccatgaactacagcttgcttcgattcgaacaaaggaggagtgatatggtgtgtcagaaa ctcctgcggcagttaccgtcaactccgcaacattgcctggaggtcaggatggacttccag gtgcctgaggagatgaagcaagcacagcagttccagaaggaagatgctgtattggtcatc tatgagatgctccagcagatcttcggtattctcaccagagacttctccagcactggctgg tctgagaccatcattgagtacctccttgtggaactccaagggcagatggatcatgtgggg ccaatccagaaggaaatcatgcggaagaaaaacttcactacgggagacatgaccattcct cacctgaagaaatattacatcaacctcgggcagtacctgaagtccatggagtacaacagc tctgcctggacagttgtgagagcagaaatgttcaagaacttttctttcctgaagagccta acaggatacctccgtgactga

DBGET integrated database retrieval system