Muntiacus reevesi (Reeves' muntjac): 136151437 Help Entry 136151437         CDS       T10466                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree01523   Antifolate resistance mree04010   MAPK signaling pathway mree04060   Cytokine-cytokine receptor interaction mree04061   Viral protein interaction with cytokine and cytokine receptor mree04064   NF-kappa B signaling pathway mree04071   Sphingolipid signaling pathway mree04150   mTOR signaling pathway mree04210   Apoptosis mree04217   Necroptosis mree04350   TGF-beta signaling pathway mree04380   Osteoclast differentiation mree04612   Antigen processing and presentation mree04620   Toll-like receptor signaling pathway mree04621   NOD-like receptor signaling pathway mree04622   RIG-I-like receptor signaling pathway mree04625   C-type lectin receptor signaling pathway mree04640   Hematopoietic cell lineage mree04650   Natural killer cell mediated cytotoxicity mree04657   IL-17 signaling pathway mree04660   T cell receptor signaling pathway mree04664   Fc epsilon RI signaling pathway mree04668   TNF signaling pathway mree04920   Adipocytokine signaling pathway mree04930   Type II diabetes mellitus mree04931   Insulin resistance mree04932   Non-alcoholic fatty liver disease mree04933   AGE-RAGE signaling pathway in diabetic complications mree04936   Alcoholic liver disease mree04940   Type I diabetes mellitus mree05010   Alzheimer disease mree05014   Amyotrophic lateral sclerosis mree05020   Prion disease mree05022   Pathways of neurodegeneration - multiple diseases mree05132   Salmonella infection mree05133   Pertussis mree05134   Legionellosis mree05135   Yersinia infection mree05140   Leishmaniasis mree05142   Chagas disease mree05143   African trypanosomiasis mree05144   Malaria mree05145   Toxoplasmosis mree05146   Amoebiasis mree05152   Tuberculosis mree05160   Hepatitis C mree05161   Hepatitis B mree05163   Human cytomegalovirus infection mree05164   Influenza A mree05165   Human papillomavirus infection mree05166   Human T-cell leukemia virus 1 infection mree05168   Herpes simplex virus 1 infection mree05169   Epstein-Barr virus infection mree05170   Human immunodeficiency virus 1 infection mree05171   Coronavirus disease - COVID-19 mree05205   Proteoglycans in cancer mree05310   Asthma mree05321   Inflammatory bowel disease mree05322   Systemic lupus erythematosus mree05323   Rheumatoid arthritis mree05330   Allograft rejection mree05332   Graft-versus-host disease mree05410   Hypertrophic cardiomyopathy mree05414   Dilated cardiomyopathy mree05417   Lipid and atherosclerosis mree05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136151437 (TNF)    04350 TGF-beta signaling pathway     136151437 (TNF)    04064 NF-kappa B signaling pathway     136151437 (TNF)    04668 TNF signaling pathway     136151437 (TNF)    04071 Sphingolipid signaling pathway     136151437 (TNF)    04150 mTOR signaling pathway     136151437 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136151437 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     136151437 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     136151437 (TNF)    04217 Necroptosis     136151437 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     136151437 (TNF)    04620 Toll-like receptor signaling pathway     136151437 (TNF)    04621 NOD-like receptor signaling pathway     136151437 (TNF)    04622 RIG-I-like receptor signaling pathway     136151437 (TNF)    04625 C-type lectin receptor signaling pathway     136151437 (TNF)    04650 Natural killer cell mediated cytotoxicity     136151437 (TNF)    04612 Antigen processing and presentation     136151437 (TNF)    04660 T cell receptor signaling pathway     136151437 (TNF)    04657 IL-17 signaling pathway     136151437 (TNF)    04664 Fc epsilon RI signaling pathway     136151437 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     136151437 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     136151437 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     136151437 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     136151437 (TNF)    05170 Human immunodeficiency virus 1 infection     136151437 (TNF)    05161 Hepatitis B     136151437 (TNF)    05160 Hepatitis C     136151437 (TNF)    05171 Coronavirus disease - COVID-19     136151437 (TNF)    05164 Influenza A     136151437 (TNF)    05168 Herpes simplex virus 1 infection     136151437 (TNF)    05163 Human cytomegalovirus infection     136151437 (TNF)    05169 Epstein-Barr virus infection     136151437 (TNF)    05165 Human papillomavirus infection     136151437 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     136151437 (TNF)    05135 Yersinia infection     136151437 (TNF)    05133 Pertussis     136151437 (TNF)    05134 Legionellosis     136151437 (TNF)    05152 Tuberculosis     136151437 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     136151437 (TNF)    05144 Malaria     136151437 (TNF)    05145 Toxoplasmosis     136151437 (TNF)    05140 Leishmaniasis     136151437 (TNF)    05142 Chagas disease     136151437 (TNF)    05143 African trypanosomiasis     136151437 (TNF)   09163 Immune disease    05310 Asthma     136151437 (TNF)    05322 Systemic lupus erythematosus     136151437 (TNF)    05323 Rheumatoid arthritis     136151437 (TNF)    05321 Inflammatory bowel disease     136151437 (TNF)    05330 Allograft rejection     136151437 (TNF)    05332 Graft-versus-host disease     136151437 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     136151437 (TNF)    05014 Amyotrophic lateral sclerosis     136151437 (TNF)    05020 Prion disease     136151437 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     136151437 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136151437 (TNF)    05418 Fluid shear stress and atherosclerosis     136151437 (TNF)    05410 Hypertrophic cardiomyopathy     136151437 (TNF)    05414 Dilated cardiomyopathy     136151437 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     136151437 (TNF)    04940 Type I diabetes mellitus     136151437 (TNF)    04936 Alcoholic liver disease     136151437 (TNF)    04932 Non-alcoholic fatty liver disease     136151437 (TNF)    04931 Insulin resistance     136151437 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     136151437 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     136151437 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mree04052]     136151437 (TNF)    00536 Glycosaminoglycan binding proteins [BR:mree00536]     136151437 (TNF) Cytokines and neuropeptides [BR:mree04052]  Cytokines   Tumor necrosis fators    136151437 (TNF) Glycosaminoglycan binding proteins [BR:mree00536]  Heparan sulfate / Heparin   Cytokines    136151437 (TNF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  136151437 NCBI-ProteinID:  XP_065768626 LinkDB All DBs Position 20:complement(28702922..28705491) Genome browser AA seq 234 aa AA seqDB search MSTKSMIRDVELAEEALSKKAGGPQGSRSCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR EEQPPTGLSINSPLVQTLRSSSQASINKPVAHVVANINAQGQLLWLDSYANALMANGVKL EDNQLVVPTDGLYLIYSQVLFRGQSCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHR ETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL NT seq 705 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaaagcatgatccgggacgtggaactggcggaggaggcgctctccaagaaa gcagggggcccccagggctccagaagttgcttgtgcctcagcctcttctccttcctcctg gttgcaggagccaccacgctcttctgcctgctgcacttcggggtaatcggcccccagagg gaagagcaacccccaactggcctctccatcaacagccctctggttcagaccctcaggtca tcttctcaagcctcaattaacaagcccgtagcccacgttgtagccaacatcaacgctcag gggcagctcctgtggctggattcgtatgccaacgccctcatggccaatggtgtgaagttg gaagacaaccagctggtggtgcctactgatgggctttacctcatctactcccaggtcctc ttcaggggccaatcctgcccttccacacccttgttcctcacccacaccatcagccgcatt gcagtctcctaccagaccaaggtcaacatcctctctgccatcaagagcccttgccacagg gagaccccagagtgggctgaggccaagccctggtacgaacccatctaccagggaggggtc ttccagctggagaagggagatcgcctcagtgctgagatcaacctgccggactacctggac tatgccgagtctggacaggtctactttgggataattgctctgtga

DBGET integrated database retrieval system