Muntiacus reevesi (Reeves' muntjac): 136155883
Help
Entry
136155883 CDS
T10466
Symbol
GNA11
Name
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
KO
K04635
guanine nucleotide-binding protein subunit alpha-11
Organism
mree Muntiacus reevesi (Reeves' muntjac)
Pathway
mree04020
Calcium signaling pathway
mree04022
cGMP-PKG signaling pathway
mree04081
Hormone signaling
mree04082
Neuroactive ligand signaling
mree04270
Vascular smooth muscle contraction
mree04540
Gap junction
mree04725
Cholinergic synapse
mree04730
Long-term depression
mree04911
Insulin secretion
mree04912
GnRH signaling pathway
mree04925
Aldosterone synthesis and secretion
mree04927
Cortisol synthesis and secretion
mree04928
Parathyroid hormone synthesis, secretion and action
mree04929
GnRH secretion
mree04934
Cushing syndrome
mree04935
Growth hormone synthesis, secretion and action
mree05142
Chagas disease
mree05146
Amoebiasis
mree05163
Human cytomegalovirus infection
mree05170
Human immunodeficiency virus 1 infection
mree05200
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:
mree00001
]
09130 Environmental Information Processing
09132 Signal transduction
04020 Calcium signaling pathway
136155883 (GNA11)
04022 cGMP-PKG signaling pathway
136155883 (GNA11)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
136155883 (GNA11)
04081 Hormone signaling
136155883 (GNA11)
09140 Cellular Processes
09144 Cellular community - eukaryotes
04540 Gap junction
136155883 (GNA11)
09150 Organismal Systems
09152 Endocrine system
04911 Insulin secretion
136155883 (GNA11)
04929 GnRH secretion
136155883 (GNA11)
04912 GnRH signaling pathway
136155883 (GNA11)
04935 Growth hormone synthesis, secretion and action
136155883 (GNA11)
04928 Parathyroid hormone synthesis, secretion and action
136155883 (GNA11)
04925 Aldosterone synthesis and secretion
136155883 (GNA11)
04927 Cortisol synthesis and secretion
136155883 (GNA11)
09153 Circulatory system
04270 Vascular smooth muscle contraction
136155883 (GNA11)
09156 Nervous system
04725 Cholinergic synapse
136155883 (GNA11)
04730 Long-term depression
136155883 (GNA11)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
136155883 (GNA11)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
136155883 (GNA11)
05163 Human cytomegalovirus infection
136155883 (GNA11)
09174 Infectious disease: parasitic
05146 Amoebiasis
136155883 (GNA11)
05142 Chagas disease
136155883 (GNA11)
09167 Endocrine and metabolic disease
04934 Cushing syndrome
136155883 (GNA11)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
mree04147
]
136155883 (GNA11)
04031 GTP-binding proteins [BR:
mree04031
]
136155883 (GNA11)
Exosome [BR:
mree04147
]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
136155883 (GNA11)
Exosomal proteins of melanoma cells
136155883 (GNA11)
GTP-binding proteins [BR:
mree04031
]
Heterotrimeric G-proteins
Alpha Subunits
Alpha type 3 (Gq/11) [OT]
136155883 (GNA11)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
G-alpha
Arf
DUF2194
Gtr1_RagA
FtsK_SpoIIIE
AAA_29
Motif
Other DBs
NCBI-GeneID:
136155883
NCBI-ProteinID:
XP_065774152
LinkDB
All DBs
Position
1:complement(199454230..199472465)
Genome browser
AA seq
359 aa
AA seq
DB search
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHRYVSAIKTLWNDPGIQECYDRRREYQLSDSAKYYLTDVDRIATSGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIVTYPWFQNSSVILFLNKKDLLEDKILHSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq
1080 nt
NT seq
+upstream
nt +downstream
nt
atgactctggagtccatgatggcgtgttgcctgagcgatgaggtgaaggagtccaagcgg
atcaacgccgagatcgagaagcagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctgctgctgctcggcacgggcgagagcgggaagagcacgttcatcaagcagatgcgc
atcatccacggggcgggctactcagaggaggacaagcggggcttcaccaaactggtgtac
cagaacatcttcactgccatgcaggccatgatccgcgccatggaaaccctgaagatcctc
tacaagtacgagcagaacaaggccaacgctctcctgatccgggaggtggacgtggagaag
gtgacgacctttgagcaccggtacgtgagcgccatcaagaccctgtggaacgaccccggc
atccaggagtgctatgaccgccggcgcgagtaccagctctcggactctgccaagtactac
ctgacggacgtggaccgcattgccacctcaggctacctgcccacccagcaggatgtgctg
cgggtgcgtgtacccaccaccggcatcatcgagtaccccttcgacctggagaacatcatc
ttcaggatggtggatgtggggggccagaggtccgagcggaggaagtggattcactgcttt
gagaacgtgacgtccatcatgttccttgtggcccttagtgagtacgaccaagtgctggtg
gagtcggacaatgagaaccgcatggaggagagcaaggcgctgttccggaccatcgtcacc
tacccctggttccagaactcatccgtcatcctcttcctcaacaagaaggacctgctggag
gacaagatcctccactcccacctggtggactacttcccagagttcgacggcccccagcgg
gacgcgcaggccgcccgggagttcatcctgaagatgtttgtggacctaaaccccgacagc
gacaagatcatctactctcacttcacctgcgccaccgacacagagaacatccgtttcgtc
ttcgccgctgtcaaggacaccatcctacagctcaacctgaaggagtacaacctggtgtga
DBGET
integrated database retrieval system