Muntiacus reevesi (Reeves' muntjac): 136166154 Help Entry 136166154         CDS       T10466                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree03050   Proteasome mree04060   Cytokine-cytokine receptor interaction mree04066   HIF-1 signaling pathway mree04217   Necroptosis mree04350   TGF-beta signaling pathway mree04380   Osteoclast differentiation mree04612   Antigen processing and presentation mree04630   JAK-STAT signaling pathway mree04650   Natural killer cell mediated cytotoxicity mree04657   IL-17 signaling pathway mree04658   Th1 and Th2 cell differentiation mree04659   Th17 cell differentiation mree04660   T cell receptor signaling pathway mree04940   Type I diabetes mellitus mree05140   Leishmaniasis mree05142   Chagas disease mree05143   African trypanosomiasis mree05144   Malaria mree05145   Toxoplasmosis mree05146   Amoebiasis mree05152   Tuberculosis mree05160   Hepatitis C mree05164   Influenza A mree05168   Herpes simplex virus 1 infection mree05200   Pathways in cancer mree05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mree05321   Inflammatory bowel disease mree05322   Systemic lupus erythematosus mree05323   Rheumatoid arthritis mree05330   Allograft rejection mree05332   Graft-versus-host disease mree05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     136166154 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     136166154 (IFNG)    04630 JAK-STAT signaling pathway     136166154 (IFNG)    04066 HIF-1 signaling pathway     136166154 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136166154 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     136166154 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     136166154 (IFNG)    04612 Antigen processing and presentation     136166154 (IFNG)    04660 T cell receptor signaling pathway     136166154 (IFNG)    04658 Th1 and Th2 cell differentiation     136166154 (IFNG)    04659 Th17 cell differentiation     136166154 (IFNG)    04657 IL-17 signaling pathway     136166154 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     136166154 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136166154 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     136166154 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     136166154 (IFNG)    05164 Influenza A     136166154 (IFNG)    05168 Herpes simplex virus 1 infection     136166154 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     136166154 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     136166154 (IFNG)    05144 Malaria     136166154 (IFNG)    05145 Toxoplasmosis     136166154 (IFNG)    05140 Leishmaniasis     136166154 (IFNG)    05142 Chagas disease     136166154 (IFNG)    05143 African trypanosomiasis     136166154 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     136166154 (IFNG)    05323 Rheumatoid arthritis     136166154 (IFNG)    05321 Inflammatory bowel disease     136166154 (IFNG)    05330 Allograft rejection     136166154 (IFNG)    05332 Graft-versus-host disease     136166154 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     136166154 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     136166154 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:mree03051]     136166154 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mree04052]     136166154 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:mree00536]     136166154 (IFNG) Proteasome [BR:mree03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     136166154 (IFNG) Cytokines and neuropeptides [BR:mree04052]  Cytokines   Interferons    136166154 (IFNG) Glycosaminoglycan binding proteins [BR:mree00536]  Heparan sulfate / Heparin   Cytokines    136166154 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma API5 DnaGprimase_HBD PAZ_2 Motif Other DBs NCBI-GeneID:  136166154 NCBI-ProteinID:  XP_065788261 LinkDB All DBs Position 4:160373759..160377906 Genome browser AA seq 166 aa AA seqDB search MKYTSYFLALQLCVLLGFSGSYGQGPFFKEIENLKEYFNASNPDVAEGGPLFIEILKNWK EESDRKIIQSQIVSFYFKLFENFKDNQVIQRSVDIIKQDMFQKFLNGSSEKLEDFQKLIQ ISVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNPFRGRRASM NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaatatacaagctatttcttagctttacagctctgcgtgcttttgggtttttctggt tcttacggccagggcccattttttaaagaaatagaaaacttaaaggagtattttaatgca agtaacccagatgtagctgagggtgggcctcttttcatagaaattttgaagaattggaaa gaggagagtgacagaaaaattattcagagccaaattgtctccttctacttcaaactcttt gaaaacttcaaagataaccaggtcattcagaggagcgtggatatcatcaagcaagacatg tttcagaagttcttgaatggcagctctgaaaaactggaggacttccaaaagctgattcaa atttcggtggatgatctgcagatccagcgcaaagccataaatgaactcatcaaagtgatg aatgacctgtcgccaaaatctaacctcagaaagcggaagagaagtcagaatccctttcga ggccggagagcatcaatgtaa

DBGET integrated database retrieval system