Muntiacus reevesi (Reeves' muntjac): 136167232 Help Entry 136167232         CDS       T10466                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree04010   MAPK signaling pathway mree04014   Ras signaling pathway mree04015   Rap1 signaling pathway mree04024   cAMP signaling pathway mree04062   Chemokine signaling pathway mree04510   Focal adhesion mree04517   IgSF CAM signaling mree04520   Adherens junction mree04611   Platelet activation mree04670   Leukocyte transendothelial migration mree04720   Long-term potentiation mree04722   Neurotrophin signaling pathway mree04934   Cushing syndrome mree04972   Pancreatic secretion mree05211   Renal cell carcinoma mree05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136167232 (RAP1B)    04014 Ras signaling pathway     136167232 (RAP1B)    04015 Rap1 signaling pathway     136167232 (RAP1B)    04024 cAMP signaling pathway     136167232 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     136167232 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     136167232 (RAP1B)    04520 Adherens junction     136167232 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     136167232 (RAP1B)    04670 Leukocyte transendothelial migration     136167232 (RAP1B)    04062 Chemokine signaling pathway     136167232 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     136167232 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     136167232 (RAP1B)    04722 Neurotrophin signaling pathway     136167232 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     136167232 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136167232 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     136167232 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mree04147]     136167232 (RAP1B)    04031 GTP-binding proteins [BR:mree04031]     136167232 (RAP1B) Exosome [BR:mree04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136167232 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    136167232 (RAP1B)   Exosomal proteins of colorectal cancer cells    136167232 (RAP1B) GTP-binding proteins [BR:mree04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     136167232 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  136167232 NCBI-ProteinID:  XP_065790746 LinkDB All DBs Position 4:complement(159943795..159987566) Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcgggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcttggatactgcagga acggaacaattcacagcaatgagggatttgtacatgaaaaatggacaaggctttgcgtta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatc cttcgagttaaagacacggatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcgacaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcgtca tgtcagctgctttaa

DBGET integrated database retrieval system