Muntiacus reevesi (Reeves' muntjac): 136171080 Help Entry 136171080         CDS       T10466                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism mree  Muntiacus reevesi (Reeves' muntjac) Pathway mree01521   EGFR tyrosine kinase inhibitor resistance mree01523   Antifolate resistance mree04060   Cytokine-cytokine receptor interaction mree04061   Viral protein interaction with cytokine and cytokine receptor mree04066   HIF-1 signaling pathway mree04068   FoxO signaling pathway mree04151   PI3K-Akt signaling pathway mree04218   Cellular senescence mree04620   Toll-like receptor signaling pathway mree04621   NOD-like receptor signaling pathway mree04623   Cytosolic DNA-sensing pathway mree04625   C-type lectin receptor signaling pathway mree04630   JAK-STAT signaling pathway mree04640   Hematopoietic cell lineage mree04657   IL-17 signaling pathway mree04659   Th17 cell differentiation mree04668   TNF signaling pathway mree04672   Intestinal immune network for IgA production mree04931   Insulin resistance mree04932   Non-alcoholic fatty liver disease mree04933   AGE-RAGE signaling pathway in diabetic complications mree04936   Alcoholic liver disease mree05010   Alzheimer disease mree05020   Prion disease mree05022   Pathways of neurodegeneration - multiple diseases mree05132   Salmonella infection mree05133   Pertussis mree05134   Legionellosis mree05135   Yersinia infection mree05142   Chagas disease mree05143   African trypanosomiasis mree05144   Malaria mree05146   Amoebiasis mree05152   Tuberculosis mree05161   Hepatitis B mree05162   Measles mree05163   Human cytomegalovirus infection mree05164   Influenza A mree05166   Human T-cell leukemia virus 1 infection mree05167   Kaposi sarcoma-associated herpesvirus infection mree05168   Herpes simplex virus 1 infection mree05169   Epstein-Barr virus infection mree05171   Coronavirus disease - COVID-19 mree05200   Pathways in cancer mree05202   Transcriptional misregulation in cancer mree05321   Inflammatory bowel disease mree05323   Rheumatoid arthritis mree05332   Graft-versus-host disease mree05410   Hypertrophic cardiomyopathy mree05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mree00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     136171080 (IL6)    04668 TNF signaling pathway     136171080 (IL6)    04066 HIF-1 signaling pathway     136171080 (IL6)    04068 FoxO signaling pathway     136171080 (IL6)    04151 PI3K-Akt signaling pathway     136171080 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136171080 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     136171080 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     136171080 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     136171080 (IL6)    04620 Toll-like receptor signaling pathway     136171080 (IL6)    04621 NOD-like receptor signaling pathway     136171080 (IL6)    04623 Cytosolic DNA-sensing pathway     136171080 (IL6)    04625 C-type lectin receptor signaling pathway     136171080 (IL6)    04659 Th17 cell differentiation     136171080 (IL6)    04657 IL-17 signaling pathway     136171080 (IL6)    04672 Intestinal immune network for IgA production     136171080 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136171080 (IL6)    05202 Transcriptional misregulation in cancer     136171080 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     136171080 (IL6)    05161 Hepatitis B     136171080 (IL6)    05171 Coronavirus disease - COVID-19     136171080 (IL6)    05164 Influenza A     136171080 (IL6)    05162 Measles     136171080 (IL6)    05168 Herpes simplex virus 1 infection     136171080 (IL6)    05163 Human cytomegalovirus infection     136171080 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     136171080 (IL6)    05169 Epstein-Barr virus infection     136171080 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     136171080 (IL6)    05135 Yersinia infection     136171080 (IL6)    05133 Pertussis     136171080 (IL6)    05134 Legionellosis     136171080 (IL6)    05152 Tuberculosis     136171080 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     136171080 (IL6)    05144 Malaria     136171080 (IL6)    05142 Chagas disease     136171080 (IL6)    05143 African trypanosomiasis     136171080 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     136171080 (IL6)    05321 Inflammatory bowel disease     136171080 (IL6)    05332 Graft-versus-host disease     136171080 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     136171080 (IL6)    05020 Prion disease     136171080 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     136171080 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136171080 (IL6)    05410 Hypertrophic cardiomyopathy     136171080 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     136171080 (IL6)    04932 Non-alcoholic fatty liver disease     136171080 (IL6)    04931 Insulin resistance     136171080 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     136171080 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     136171080 (IL6)    01523 Antifolate resistance     136171080 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mree04052]     136171080 (IL6) Cytokines and neuropeptides [BR:mree04052]  Cytokines   Interleukins    136171080 (IL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 IL23 GCSF MIP-T3_C Motif Other DBs NCBI-GeneID:  136171080 NCBI-ProteinID:  XP_065795848 LinkDB All DBs Position 6:29754102..29758569 Genome browser AA seq 237 aa AA seqDB search MRPGMSETQSALEPTRNERELHLPSRNPAMNSLFTSAFSPLAVSLGLLLVMASAFPTRGP LGEDFKNDTTPSRLLLTTPDKTEALIKHIVDKISAMRKEICEKNDKCENSKETLAENNLN LPKMEEKDGCFQSGFNQETCLTRSTVGLLEYQTYLDYLQNVYEGDQENVKDLRSSIRTLL QIMRQKSTDLVTTPTTNPDLLEKMQSSNEWVKNAKIILILRSLENFLQFSLRAIRMK NT seq 714 nt NT seq  +upstreamnt  +downstreamnt atgagaccggggatgtctgagactcagtctgccctcgagcccaccaggaacgaaagagag ctccatctgccctccaggaacccagctatgaactccctcttcacaagcgccttcagtcca ctcgctgtctccctggggctgctcctggtgatggcttctgcttttcctacccggggtccc ctgggagaagatttcaaaaatgacaccaccccaagcagactacttctgaccactccagac aaaaccgaagctctcattaagcacatcgtcgacaaaatctctgcaatgagaaaggagata tgtgagaagaatgacaagtgtgaaaacagcaaggagacactggcagaaaataacctgaat cttccaaaaatggaggaaaaagatggatgcttccaatctgggttcaatcaggagacttgc ttgaccagaagcactgttggtcttctggagtatcagacatacctggactacctccagaat gtgtatgagggagatcaggaaaatgtcaaggatttgcggagcagcatcagaacactgctc cagatcatgaggcaaaagagcacagatctagtaaccactccaaccacaaacccggacctg ctggagaagatgcagtcctcaaacgagtgggtaaagaacgcaaagattatcctcatcctg agaagccttgagaatttcctgcagttcagcctgagagctattcggatgaagtag

DBGET integrated database retrieval system