Mauremys reevesii (Reeves's turtle): 120368645 Help Entry 120368645         CDS       T07797                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism mrv  Mauremys reevesii (Reeves's turtle) Pathway mrv04060   Cytokine-cytokine receptor interaction mrv04672   Intestinal immune network for IgA production mrv04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:mrv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120368645 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     120368645 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     120368645 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mrv04052]     120368645 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:mrv00536]     120368645 (CXCL12) Cytokines and neuropeptides [BR:mrv04052]  Cytokines   Chemokines    120368645 (CXCL12) Glycosaminoglycan binding proteins [BR:mrv00536]  Heparan sulfate / Heparin   Chemokines    120368645 (CXCL12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  120368645 NCBI-ProteinID:  XP_039336850 LinkDB All DBs Position LG7:65468957..65490795 Genome browser AA seq 91 aa AA seqDB search MDGKALALITCLLLSLSEEKPVSLTYRCPCRFYESNVAKANIKHLKILTTPNCSLQIVAR LKNNSKQVCIDPKLKWIQEYLEKALNKRFKM NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggacgggaaagccctggcgctgatcacttgtctgctgctctccctctcggaggagaaa cccgtcagcctgacctaccgatgcccctgcaggttctatgagagcaacgtggctaaagcc aacatcaagcacctcaaaatcctgaccaccccgaactgctcgctgcagattgtcgcaagg ctgaagaacaacagtaagcaagtgtgcattgatcccaagttaaagtggattcaggaatat ctggaaaaagctttaaacaagaggttcaagatgtaa

DBGET integrated database retrieval system