Mauremys reevesii (Reeves's turtle): 120374473 Help Entry 120374473         CDS       T07797                                  Name (RefSeq) actin, cytoplasmic type 5-like   KO K05692   actin beta/gamma 1 Organism mrv  Mauremys reevesii (Reeves's turtle) Pathway mrv03082   ATP-dependent chromatin remodeling mrv04145   Phagosome mrv04210   Apoptosis mrv04510   Focal adhesion mrv04520   Adherens junction mrv04530   Tight junction mrv04810   Regulation of actin cytoskeleton mrv04814   Motor proteins mrv04820   Cytoskeleton in muscle cells mrv05100   Bacterial invasion of epithelial cells mrv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mrv00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     120374473  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     120374473   09143 Cell growth and death    04210 Apoptosis     120374473   09144 Cellular community - eukaryotes    04510 Focal adhesion     120374473    04520 Adherens junction     120374473    04530 Tight junction     120374473   09142 Cell motility    04814 Motor proteins     120374473    04820 Cytoskeleton in muscle cells     120374473    04810 Regulation of actin cytoskeleton     120374473  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120374473    05100 Bacterial invasion of epithelial cells     120374473  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mrv03021]     120374473    03019 Messenger RNA biogenesis [BR:mrv03019]     120374473    03036 Chromosome and associated proteins [BR:mrv03036]     120374473    03029 Mitochondrial biogenesis [BR:mrv03029]     120374473   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mrv04812]     120374473    04147 Exosome [BR:mrv04147]     120374473 Transcription machinery [BR:mrv03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      120374473 Messenger RNA biogenesis [BR:mrv03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      120374473 Chromosome and associated proteins [BR:mrv03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      120374473     NuA4 complex      120374473   Chromatin remodeling factors    BAF complex     120374473    PBAF complex     120374473    GBAF(ncBAF) complex     120374473    SWR1 complex     120374473 Mitochondrial biogenesis [BR:mrv03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     120374473 Cytoskeleton proteins [BR:mrv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      120374473 Exosome [BR:mrv04147]  Exosomal proteins   Proteins found in most exosomes    120374473 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin DUF6581 Motif Other DBs NCBI-GeneID:  120374473 NCBI-ProteinID:  XP_039350147 LinkDB All DBs Position LG11:complement(66730656..66731399) Genome browser AA seq 239 aa AA seqDB search MLHDSSFTQMMFETFNTPAMHVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP HAILRLDLAGRDLTDYLMKIMTERGYSFTTATEREIVRDIKEKLCYVALDFEQEMATAAS SSSLEKSYELPDGQVITIGNERFRCPEAILQSSFLGMESCGIHETTFNSIMKCDVDIRKD LYANMVLSGGSTMYPGIADRMQKEITALAPSTMKIKIIAPLERKYSVWIGGSRRDSSVV NT seq 720 nt NT seq  +upstreamnt  +downstreamnt atgctgcatgactccagttttacgcagatgatgtttgagaccttcaacaccccagctatg catgtggctatccaggctgtgctgtccctgtatgcctctgggcgtactacaggtatcgtc atggactctggcgatggggtcacccacacagtgccaatctacgagggctacgccctgccc catgccatcctgcgtctggacttggctggccgtgacctgactgactacctcatgaagatc atgacggagagaggctacagcttcaccactgcgaccgaaagggaaattgtgcgtgacatc aaggagaagctctgctatgtcgccttggacttcgagcaggaaatggccacggctgcttca tcttcctccctggagaagagctatgagctacctgatggtcaggtgatcactattgggaac gaaaggttccggtgcccagaggcaatcttgcagtcctccttcctggggatggagtcctgt ggcattcacgagaccactttcaactccatcatgaagtgtgacgtagatatccgaaaggac ctctatgctaacatggtgctgtctgggggaagcaccatgtatcctggcattgctgacaga atgcagaaggagatcacggccctggcacccagcacaatgaaaatcaagatcattgcccca ctggagcgtaaatattccgtctggattggtggctccaggagggatagctcagtggtttga

DBGET integrated database retrieval system