Mauremys reevesii (Reeves's turtle): 120391414 Help Entry 120391414         CDS       T07797                                  Name (RefSeq) hepatic lectin-like isoform X1   KO K06563   C-type lectin domain family 4 member L/M Organism mrv  Mauremys reevesii (Reeves's turtle) Pathway mrv03260   Virion - Human immunodeficiency virus mrv03264   Virion - Flavivirus and Alphavirus mrv03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus mrv03273   Virion - Lassa virus and SFTS virus mrv04145   Phagosome mrv04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:mrv00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     120391414    03264 Virion - Flavivirus and Alphavirus     120391414    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     120391414    03273 Virion - Lassa virus and SFTS virus     120391414  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     120391414  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120391414  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mrv04131]     120391414   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:mrv04054]     120391414    04515 Cell adhesion molecules [BR:mrv04515]     120391414    04090 CD molecules [BR:mrv04090]     120391414    04091 Lectins [BR:mrv04091]     120391414 Membrane trafficking [BR:mrv04131]  Endocytosis   Phagocytosis    C-lectin receptors     120391414 Pattern recognition receptors [BR:mrv04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    120391414 Cell adhesion molecules [BR:mrv04515]  Lectins   Selectins and C-type lectins    120391414 CD molecules [BR:mrv04090]  Proteins   120391414 Lectins [BR:mrv04091]  C-Type lectins   Asialoglycoprotein and DC receptors    120391414 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  120391414 NCBI-ProteinID:  XP_039371022 LinkDB All DBs Position LG25:5751536..5787480 Genome browser AA seq 155 aa AA seqDB search MPNAPGEPQWDQEDPGTWAGVCPLSVIPPLTNRQLVIPTLIIVAIKLLLMTLVLLYRVPW CQSGWDQDQGRCYLLSQANQTWEAARNSCLAQNADLVVINDQREQDYLAIKARSIRHWIG FTDQGTEGIWRWVDNTSAVFTFQDSLSPQHLAATA NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgcccaacgcacctggagaacctcagtgggaccaggaggacccaggaacatgggctggg gtctgtcccctctctgtgattccccctctcacgaaccggcagctggtgattcctaccctg atcatcgtggccatcaaactgctcctgatgaccctggtcctcctctaccgtgttccctgg tgccagtcgggctgggaccaggaccaagggaggtgctaccttctctcccaggctaaccag acctgggaggcagcgagaaactcctgcttagcccagaatgctgatctggtggtgatcaac gaccaaagggagcaggattacttggctattaaagctcgttccattcggcactggatcggc ttcaccgaccaagggactgaaggcatctggcgctgggtggacaacacttctgcggtattt actttccaggattcgctgtcacctcagcatctcgctgctactgcgtaa

DBGET integrated database retrieval system