Manduca sexta (tobacco hornworm): 115445862 Help Entry 115445862         CDS       T07401                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism msex  Manduca sexta (tobacco hornworm) Pathway msex03420   Nucleotide excision repair msex04120   Ubiquitin mediated proteolysis msex04141   Protein processing in endoplasmic reticulum msex04310   Wnt signaling pathway msex04341   Hedgehog signaling pathway - fly msex04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:msex00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115445862    04120 Ubiquitin mediated proteolysis     115445862   09124 Replication and repair    03420 Nucleotide excision repair     115445862  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     115445862    04341 Hedgehog signaling pathway - fly     115445862    04350 TGF-beta signaling pathway     115445862  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:msex04121]     115445862    03400 DNA repair and recombination proteins [BR:msex03400]     115445862 Enzymes [BR:msex01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      115445862 Ubiquitin system [BR:msex04121]  Ubiquitin ligases (E3)   UBL E3 ligases    115445862   Multi subunit type E3    SCF complex     Ring finger protein      115445862    Cul2 complex      115445862    Cul3 complex      115445862    Cul4 complex      115445862    Cul7 complex      115445862    Cul8 complex      115445862    Cul9 complex      115445862 DNA repair and recombination proteins [BR:msex03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       115445862     TCR (transcription coupled repair) factors      Cul4-CSA complex       115445862 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 PHD_NSD zf-RING_16 Motif Other DBs NCBI-GeneID:  115445862 NCBI-ProteinID:  XP_030028197 LinkDB All DBs Position 22:complement(9392062..9393478) Genome browser AA seq 113 aa AA seqDB search MASVMEVDEEEVEMASSSSGKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcttctgtaatggaagttgacgaggaagaagttgaaatggcttcctccagtagtggt aagggtgacaaaaaaaggttcgaagtaaagaagtggaatgctgttgcgctatgggcatgg gacatagtggtcgacaactgcgctatttgtcgtaaccatatcatggatctctgcatcgag tgtcaggccaatcaggcatccgctactagcgaggaatgcacagtggcctggggtgtctgc aatcatgcattccacttccactgcatatcacgctggctcaaaactcgacaagtttgtccc ttggataatagagagtgggaattccaaaagtatggtcattag

DBGET integrated database retrieval system