Magnolia sinica: 131251730 Help Entry 131251730         CDS       T09699                                  Name (RefSeq) RING-box protein 1a isoform X1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism msin  Magnolia sinica Pathway msin03420   Nucleotide excision repair msin04120   Ubiquitin mediated proteolysis msin04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:msin00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131251730    04120 Ubiquitin mediated proteolysis     131251730   09124 Replication and repair    03420 Nucleotide excision repair     131251730  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:msin04121]     131251730    03400 DNA repair and recombination proteins [BR:msin03400]     131251730 Enzymes [BR:msin01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      131251730 Ubiquitin system [BR:msin04121]  Ubiquitin ligases (E3)   UBL E3 ligases    131251730   Multi subunit type E3    SCF complex     Ring finger protein      131251730    Cul2 complex      131251730    Cul3 complex      131251730    Cul4 complex      131251730    Cul7 complex      131251730    Cul8 complex      131251730    Cul9 complex      131251730 DNA repair and recombination proteins [BR:msin03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       131251730     TCR (transcription coupled repair) factors      Cul4-CSA complex       131251730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  131251730 NCBI-ProteinID:  XP_058108626 LinkDB All DBs Position 7:complement(92726460..92739558) Genome browser AA seq 121 aa AA seqDB search MASLDTDINMIPAGEGSSGAGPSSSSSSAKKPKRFEIKKWNAVALWAWDIVVDNCAICRN HIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYG H NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggcgtctctggatacggatatcaacatgatcccagcaggggagggttcgagcggtgcg ggcccttcgtcctcctcttcttctgcgaagaaaccgaagcgattcgagatcaagaagtgg aacgccgttgctctttgggcctgggatatcgtcgttgacaactgcgccatctgcaggaac catatcatggatctctgtatcgagtgccaagcgaatcaagcgagtgcaacaagtgaggag tgcacagtagcatggggtgtatgcaatcatgcattccacttccactgtatcagccgatgg ctcaaaactcgccaagtgtgtccgctggataacagcgagtgggaatttcagaagtacggt cactag

DBGET integrated database retrieval system