Mannheimia succiniciproducens: MS1858 Help Entry MS1858            CDS       T00201                                  Symbol folA Name (GenBank) FolA protein   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism msu  Mannheimia succiniciproducens Pathway msu00670   One carbon pool by folate msu00790   Folate biosynthesis msu01100   Metabolic pathways msu01240   Biosynthesis of cofactors msu04981   Folate transport and metabolism Module msu_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:msu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     MS1858 (folA)    00670 One carbon pool by folate     MS1858 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     MS1858 (folA) Enzymes [BR:msu01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      MS1858 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AAU38465 UniProt:  Q65RE5 LinkDB All DBs Position complement(1850229..1850714) Genome browser AA seq 161 aa AA seqDB search MTLSLIVAATKNHVIGKDNQMPWHLPADLKWFKENTLGKPVIMGRKTFESIGRPLPKRVN IVLSRHPFEHEGVIWKESLESAVDFLKDSAEIMLIGGGQLFEQYLSQADKLYFTEIQTEL EGDTFFPAINTDEWEISYEEYRPADENNAYDLRFLILERKS NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgacattgagtttaatcgtcgcagccacaaaaaaccatgtaatcggtaaagataaccaa atgccctggcatttacctgcagatctaaaatggtttaaagaaaacacgcttggaaaaccg gttattatggggcgcaaaacctttgaaagtatcggtcgcccgttgcctaagcgcgtgaat attgtgctttcccgtcatcctttcgaacatgaaggcgttatatggaaagaaagcctggaa agtgcggtagattttttgaaagattcagccgaaattatgcttatcggcggcggacagtta ttcgagcaatatttatctcaagcggataaactgtacttcacggaaattcagacggaactt gaaggcgatacctttttcccggcaattaatacggacgaatgggaaatttcctatgaggaa tatcgcccggcggatgaaaataacgcctatgatttacggtttttaatcttagagcgcaaa tcctaa

DBGET integrated database retrieval system