KEGG   Malus sylvestris (European crab apple): 126605099
Entry
126605099         CDS       T09027                                 
Name
(RefSeq) uncharacterized protein LOC126605099
  KO
K26502  transmembrane protein 258
Organism
msyl  Malus sylvestris (European crab apple)
Pathway
msyl00510  N-Glycan biosynthesis
msyl00513  Various types of N-glycan biosynthesis
msyl04141  Protein processing in endoplasmic reticulum
Module
msyl_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:msyl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    126605099
   00513 Various types of N-glycan biosynthesis
    126605099
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    126605099
SSDB
Motif
Pfam: Ost5 LHC ATP-synt_8
Other DBs
NCBI-GeneID: 126605099
NCBI-ProteinID: XP_050128408
LinkDB
Position
15:complement(16320512..16322043)
AA seq 76 aa
MAPKAITSPVPITWYPTLAVVMVSLGLLFTASFFIHAATISRKNRSLAKEITTGTLASFF
LGFGTLYVLLASGVYV
NT seq 231 nt   +upstreamnt  +downstreamnt
atggctccgaaggcaattaccagtcccgtgccgatcacgtggtacccgaccctcgccgtc
gtgatggtctccctcggcctcctcttcacggcttccttcttcatccatgcggcgaccatt
tccaggaaaaaccgcagtcttgcgaaggaaattacgacaggaacattggcttcgttcttt
ttgggtttcggaaccttgtacgtactgcttgcatcgggcgtttatgtctga

DBGET integrated database retrieval system