Malus sylvestris (European crab apple): 126613786 Help Entry 126613786         CDS       T09027                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism msyl  Malus sylvestris (European crab apple) Pathway msyl03420   Nucleotide excision repair msyl04120   Ubiquitin mediated proteolysis msyl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:msyl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     126613786    04120 Ubiquitin mediated proteolysis     126613786   09124 Replication and repair    03420 Nucleotide excision repair     126613786  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:msyl04121]     126613786    03400 DNA repair and recombination proteins [BR:msyl03400]     126613786 Enzymes [BR:msyl01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      126613786 Ubiquitin system [BR:msyl04121]  Ubiquitin ligases (E3)   UBL E3 ligases    126613786   Multi subunit type E3    SCF complex     Ring finger protein      126613786    Cul2 complex      126613786    Cul3 complex      126613786    Cul4 complex      126613786    Cul7 complex      126613786    Cul8 complex      126613786    Cul9 complex      126613786 DNA repair and recombination proteins [BR:msyl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       126613786     TCR (transcription coupled repair) factors      Cul4-CSA complex       126613786 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  126613786 NCBI-ProteinID:  XP_050137343 LinkDB All DBs Position 2:complement(17972538..17980422) Genome browser AA seq 116 aa AA seqDB search MATLDSDVPMVPVGEGSRSAGSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggccacattggattctgatgtcccgatggttccggtaggtgagggttcgagaagtgca ggttcttcgaccaagaagcccaagcggtttgagatcaagaagtggaatgctgtcgctcta tgggcctgggatattgttgttgataactgtgccatttgcaggaaccatatcatggatctc tgcattgagtgccaagcaaaccaggcaagcgcgacgagtgaagaatgtacagttgcttgg ggggtttgcaaccatgcatttcacttccactgcataagccgatggctcaagacacgccaa gtgtgtccgttagataatagcgagtgggaatttcagaaatatggtcattag

DBGET integrated database retrieval system