Moorella thermoacetica ATCC 39073: Moth_0407 Help Entry Moth_0407         CDS       T00308                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mta  Moorella thermoacetica ATCC 39073 Pathway mta00790   Folate biosynthesis mta01100   Metabolic pathways mta01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:mta00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Moth_0407 Enzymes [BR:mta01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Moth_0407  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Moth_0407  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Moth_0407 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ABC18741 UniProt:  Q2RLE8 LinkDB All DBs Position complement(412557..412925) Genome browser AA seq 122 aa AA seqDB search MGQDKIILAGLEFYGFHGNHPAEQQLGQPFIVDLELYLDLEPAGRTDALEATVNYGQVYR LVQEIVTGRPYKLLEALAAAISDGILAGFPVDEVLVRVKKPRAPLPGSFDYAAVEIRRRR KE NT seq 369 nt NT seq  +upstreamnt  +downstreamnt ttgggtcaggataagattattttagccgggctggagttttatggcttccacggcaaccat ccggcagagcagcagttggggcagccctttattgtcgacctcgaactctacctggacctg gaacctgccgggaggaccgatgctctggaagccaccgtcaactacggccaggtctaccgc ctggtgcaggaaatagtcaccggccgcccctataaactcctggaggccctggccgcggcc atcagcgacggcattctggccggtttcccggtggacgaggtcctggtgcgtgtaaaaaaa ccccgggcaccactgcccgggagctttgactacgccgccgttgagatccggcgccggaga aaagaatag

DBGET integrated database retrieval system