KEGG   Macaca thibetana thibetana (Pere David's macaque): 126953141
Entry
126953141         CDS       T08579                                 
Name
(RefSeq) tumor necrosis factor isoform X1
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
mthb  Macaca thibetana thibetana (Pere David's macaque)
Pathway
mthb01523  Antifolate resistance
mthb04010  MAPK signaling pathway
mthb04060  Cytokine-cytokine receptor interaction
mthb04061  Viral protein interaction with cytokine and cytokine receptor
mthb04064  NF-kappa B signaling pathway
mthb04071  Sphingolipid signaling pathway
mthb04150  mTOR signaling pathway
mthb04210  Apoptosis
mthb04217  Necroptosis
mthb04350  TGF-beta signaling pathway
mthb04380  Osteoclast differentiation
mthb04612  Antigen processing and presentation
mthb04620  Toll-like receptor signaling pathway
mthb04621  NOD-like receptor signaling pathway
mthb04622  RIG-I-like receptor signaling pathway
mthb04625  C-type lectin receptor signaling pathway
mthb04640  Hematopoietic cell lineage
mthb04650  Natural killer cell mediated cytotoxicity
mthb04657  IL-17 signaling pathway
mthb04660  T cell receptor signaling pathway
mthb04664  Fc epsilon RI signaling pathway
mthb04668  TNF signaling pathway
mthb04920  Adipocytokine signaling pathway
mthb04930  Type II diabetes mellitus
mthb04931  Insulin resistance
mthb04932  Non-alcoholic fatty liver disease
mthb04933  AGE-RAGE signaling pathway in diabetic complications
mthb04936  Alcoholic liver disease
mthb04940  Type I diabetes mellitus
mthb05010  Alzheimer disease
mthb05014  Amyotrophic lateral sclerosis
mthb05020  Prion disease
mthb05022  Pathways of neurodegeneration - multiple diseases
mthb05132  Salmonella infection
mthb05133  Pertussis
mthb05134  Legionellosis
mthb05135  Yersinia infection
mthb05140  Leishmaniasis
mthb05142  Chagas disease
mthb05143  African trypanosomiasis
mthb05144  Malaria
mthb05145  Toxoplasmosis
mthb05146  Amoebiasis
mthb05152  Tuberculosis
mthb05160  Hepatitis C
mthb05161  Hepatitis B
mthb05163  Human cytomegalovirus infection
mthb05164  Influenza A
mthb05165  Human papillomavirus infection
mthb05166  Human T-cell leukemia virus 1 infection
mthb05168  Herpes simplex virus 1 infection
mthb05169  Epstein-Barr virus infection
mthb05170  Human immunodeficiency virus 1 infection
mthb05171  Coronavirus disease - COVID-19
mthb05205  Proteoglycans in cancer
mthb05310  Asthma
mthb05321  Inflammatory bowel disease
mthb05322  Systemic lupus erythematosus
mthb05323  Rheumatoid arthritis
mthb05330  Allograft rejection
mthb05332  Graft-versus-host disease
mthb05410  Hypertrophic cardiomyopathy
mthb05414  Dilated cardiomyopathy
mthb05417  Lipid and atherosclerosis
mthb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mthb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    126953141
   04350 TGF-beta signaling pathway
    126953141
   04064 NF-kappa B signaling pathway
    126953141
   04668 TNF signaling pathway
    126953141
   04071 Sphingolipid signaling pathway
    126953141
   04150 mTOR signaling pathway
    126953141
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    126953141
   04061 Viral protein interaction with cytokine and cytokine receptor
    126953141
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    126953141
   04217 Necroptosis
    126953141
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    126953141
   04620 Toll-like receptor signaling pathway
    126953141
   04621 NOD-like receptor signaling pathway
    126953141
   04622 RIG-I-like receptor signaling pathway
    126953141
   04625 C-type lectin receptor signaling pathway
    126953141
   04650 Natural killer cell mediated cytotoxicity
    126953141
   04612 Antigen processing and presentation
    126953141
   04660 T cell receptor signaling pathway
    126953141
   04657 IL-17 signaling pathway
    126953141
   04664 Fc epsilon RI signaling pathway
    126953141
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    126953141
  09158 Development and regeneration
   04380 Osteoclast differentiation
    126953141
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    126953141
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    126953141
   05170 Human immunodeficiency virus 1 infection
    126953141
   05161 Hepatitis B
    126953141
   05160 Hepatitis C
    126953141
   05171 Coronavirus disease - COVID-19
    126953141
   05164 Influenza A
    126953141
   05168 Herpes simplex virus 1 infection
    126953141
   05163 Human cytomegalovirus infection
    126953141
   05169 Epstein-Barr virus infection
    126953141
   05165 Human papillomavirus infection
    126953141
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    126953141
   05135 Yersinia infection
    126953141
   05133 Pertussis
    126953141
   05134 Legionellosis
    126953141
   05152 Tuberculosis
    126953141
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    126953141
   05144 Malaria
    126953141
   05145 Toxoplasmosis
    126953141
   05140 Leishmaniasis
    126953141
   05142 Chagas disease
    126953141
   05143 African trypanosomiasis
    126953141
  09163 Immune disease
   05310 Asthma
    126953141
   05322 Systemic lupus erythematosus
    126953141
   05323 Rheumatoid arthritis
    126953141
   05321 Inflammatory bowel disease
    126953141
   05330 Allograft rejection
    126953141
   05332 Graft-versus-host disease
    126953141
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    126953141
   05014 Amyotrophic lateral sclerosis
    126953141
   05020 Prion disease
    126953141
   05022 Pathways of neurodegeneration - multiple diseases
    126953141
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    126953141
   05418 Fluid shear stress and atherosclerosis
    126953141
   05410 Hypertrophic cardiomyopathy
    126953141
   05414 Dilated cardiomyopathy
    126953141
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    126953141
   04940 Type I diabetes mellitus
    126953141
   04936 Alcoholic liver disease
    126953141
   04932 Non-alcoholic fatty liver disease
    126953141
   04931 Insulin resistance
    126953141
   04933 AGE-RAGE signaling pathway in diabetic complications
    126953141
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    126953141
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:mthb04052]
    126953141
   00536 Glycosaminoglycan binding proteins [BR:mthb00536]
    126953141
Cytokines and neuropeptides [BR:mthb04052]
 Cytokines
  Tumor necrosis fators
   126953141
Glycosaminoglycan binding proteins [BR:mthb00536]
 Heparan sulfate / Heparin
  Cytokines
   126953141
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 126953141
NCBI-ProteinID: XP_050644482
LinkDB
Position
4:32048680..32051663
AA seq 236 aa
MKIGCLAHRRHSVKELLNAWRVNIQMNGERKPDNSGLRAQVRQAASCSSFKGDSLDVNHS
PSPQQFPKDPSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGV
ELTDNQLVVPSEGLYLIYSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAIKSPC
QRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 711 nt   +upstreamnt  +downstreamnt
atgaagataggatgtctggcacacagaagacactcagtgaaagagttgttgaatgcatgg
agggtgaatatacagatgaatggagagagaaaaccggacaactcagggctaagagcgcag
gtcagacaggcagccagctgttcctcctttaagggtgattcccttgatgttaaccattct
ccttctccccaacagttccccaaggacccctctctaatcagccctctggctcaggcagtc
agatcatcttctcgaaccccaagtgacaagcctgtagcccatgttgtagcaaaccctcaa
gctgaggggcagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtg
gagctgacagataaccagctggtggtgccatcagaaggcctgtacctcatctactcccag
gtcctcttcaagggccaaggctgcccctccaaccatgtgctcctcacccacaccatcagc
cgcatcgccgtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgc
cagagggagactccagagggggctgaggccaagccctggtatgagcccatctacctagga
ggggtctttcagctggagaagggtgatcgactcagcgctgagatcaatctgcccgactat
ctcgactttgccgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system