KEGG   Macaca thibetana thibetana (Pere David's macaque): 126961422
Entry
126961422         CDS       T08579                                 
Name
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mthb  Macaca thibetana thibetana (Pere David's macaque)
Pathway
mthb01521  EGFR tyrosine kinase inhibitor resistance
mthb01522  Endocrine resistance
mthb01524  Platinum drug resistance
mthb04012  ErbB signaling pathway
mthb04014  Ras signaling pathway
mthb04015  Rap1 signaling pathway
mthb04024  cAMP signaling pathway
mthb04062  Chemokine signaling pathway
mthb04066  HIF-1 signaling pathway
mthb04068  FoxO signaling pathway
mthb04070  Phosphatidylinositol signaling system
mthb04071  Sphingolipid signaling pathway
mthb04072  Phospholipase D signaling pathway
mthb04081  Hormone signaling
mthb04140  Autophagy - animal
mthb04150  mTOR signaling pathway
mthb04151  PI3K-Akt signaling pathway
mthb04152  AMPK signaling pathway
mthb04210  Apoptosis
mthb04211  Longevity regulating pathway
mthb04213  Longevity regulating pathway - multiple species
mthb04218  Cellular senescence
mthb04360  Axon guidance
mthb04370  VEGF signaling pathway
mthb04380  Osteoclast differentiation
mthb04510  Focal adhesion
mthb04517  IgSF CAM signaling
mthb04550  Signaling pathways regulating pluripotency of stem cells
mthb04611  Platelet activation
mthb04613  Neutrophil extracellular trap formation
mthb04620  Toll-like receptor signaling pathway
mthb04625  C-type lectin receptor signaling pathway
mthb04630  JAK-STAT signaling pathway
mthb04650  Natural killer cell mediated cytotoxicity
mthb04660  T cell receptor signaling pathway
mthb04662  B cell receptor signaling pathway
mthb04664  Fc epsilon RI signaling pathway
mthb04666  Fc gamma R-mediated phagocytosis
mthb04668  TNF signaling pathway
mthb04670  Leukocyte transendothelial migration
mthb04722  Neurotrophin signaling pathway
mthb04725  Cholinergic synapse
mthb04750  Inflammatory mediator regulation of TRP channels
mthb04810  Regulation of actin cytoskeleton
mthb04910  Insulin signaling pathway
mthb04914  Progesterone-mediated oocyte maturation
mthb04915  Estrogen signaling pathway
mthb04917  Prolactin signaling pathway
mthb04919  Thyroid hormone signaling pathway
mthb04923  Regulation of lipolysis in adipocytes
mthb04926  Relaxin signaling pathway
mthb04929  GnRH secretion
mthb04930  Type II diabetes mellitus
mthb04931  Insulin resistance
mthb04932  Non-alcoholic fatty liver disease
mthb04933  AGE-RAGE signaling pathway in diabetic complications
mthb04935  Growth hormone synthesis, secretion and action
mthb04960  Aldosterone-regulated sodium reabsorption
mthb04973  Carbohydrate digestion and absorption
mthb05010  Alzheimer disease
mthb05017  Spinocerebellar ataxia
mthb05020  Prion disease
mthb05100  Bacterial invasion of epithelial cells
mthb05135  Yersinia infection
mthb05142  Chagas disease
mthb05146  Amoebiasis
mthb05160  Hepatitis C
mthb05161  Hepatitis B
mthb05162  Measles
mthb05163  Human cytomegalovirus infection
mthb05164  Influenza A
mthb05165  Human papillomavirus infection
mthb05166  Human T-cell leukemia virus 1 infection
mthb05167  Kaposi sarcoma-associated herpesvirus infection
mthb05168  Herpes simplex virus 1 infection
mthb05169  Epstein-Barr virus infection
mthb05170  Human immunodeficiency virus 1 infection
mthb05171  Coronavirus disease - COVID-19
mthb05200  Pathways in cancer
mthb05203  Viral carcinogenesis
mthb05205  Proteoglycans in cancer
mthb05206  MicroRNAs in cancer
mthb05207  Chemical carcinogenesis - receptor activation
mthb05208  Chemical carcinogenesis - reactive oxygen species
mthb05210  Colorectal cancer
mthb05211  Renal cell carcinoma
mthb05212  Pancreatic cancer
mthb05213  Endometrial cancer
mthb05214  Glioma
mthb05215  Prostate cancer
mthb05218  Melanoma
mthb05220  Chronic myeloid leukemia
mthb05221  Acute myeloid leukemia
mthb05222  Small cell lung cancer
mthb05223  Non-small cell lung cancer
mthb05224  Breast cancer
mthb05225  Hepatocellular carcinoma
mthb05226  Gastric cancer
mthb05230  Central carbon metabolism in cancer
mthb05231  Choline metabolism in cancer
mthb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mthb05415  Diabetic cardiomyopathy
mthb05417  Lipid and atherosclerosis
mthb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mthb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    126961422
   04014 Ras signaling pathway
    126961422
   04015 Rap1 signaling pathway
    126961422
   04370 VEGF signaling pathway
    126961422
   04630 JAK-STAT signaling pathway
    126961422
   04668 TNF signaling pathway
    126961422
   04066 HIF-1 signaling pathway
    126961422
   04068 FoxO signaling pathway
    126961422
   04070 Phosphatidylinositol signaling system
    126961422
   04072 Phospholipase D signaling pathway
    126961422
   04071 Sphingolipid signaling pathway
    126961422
   04024 cAMP signaling pathway
    126961422
   04151 PI3K-Akt signaling pathway
    126961422
   04152 AMPK signaling pathway
    126961422
   04150 mTOR signaling pathway
    126961422
  09133 Signaling molecules and interaction
   04081 Hormone signaling
    126961422
   04517 IgSF CAM signaling
    126961422
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    126961422
  09143 Cell growth and death
   04210 Apoptosis
    126961422
   04218 Cellular senescence
    126961422
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    126961422
   04550 Signaling pathways regulating pluripotency of stem cells
    126961422
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    126961422
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    126961422
   04613 Neutrophil extracellular trap formation
    126961422
   04620 Toll-like receptor signaling pathway
    126961422
   04625 C-type lectin receptor signaling pathway
    126961422
   04650 Natural killer cell mediated cytotoxicity
    126961422
   04660 T cell receptor signaling pathway
    126961422
   04662 B cell receptor signaling pathway
    126961422
   04664 Fc epsilon RI signaling pathway
    126961422
   04666 Fc gamma R-mediated phagocytosis
    126961422
   04670 Leukocyte transendothelial migration
    126961422
   04062 Chemokine signaling pathway
    126961422
  09152 Endocrine system
   04910 Insulin signaling pathway
    126961422
   04923 Regulation of lipolysis in adipocytes
    126961422
   04929 GnRH secretion
    126961422
   04915 Estrogen signaling pathway
    126961422
   04914 Progesterone-mediated oocyte maturation
    126961422
   04917 Prolactin signaling pathway
    126961422
   04926 Relaxin signaling pathway
    126961422
   04935 Growth hormone synthesis, secretion and action
    126961422
   04919 Thyroid hormone signaling pathway
    126961422
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    126961422
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    126961422
  09156 Nervous system
   04725 Cholinergic synapse
    126961422
   04722 Neurotrophin signaling pathway
    126961422
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    126961422
  09158 Development and regeneration
   04360 Axon guidance
    126961422
   04380 Osteoclast differentiation
    126961422
  09149 Aging
   04211 Longevity regulating pathway
    126961422
   04213 Longevity regulating pathway - multiple species
    126961422
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    126961422
   05206 MicroRNAs in cancer
    126961422
   05205 Proteoglycans in cancer
    126961422
   05207 Chemical carcinogenesis - receptor activation
    126961422
   05208 Chemical carcinogenesis - reactive oxygen species
    126961422
   05203 Viral carcinogenesis
    126961422
   05230 Central carbon metabolism in cancer
    126961422
   05231 Choline metabolism in cancer
    126961422
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    126961422
  09162 Cancer: specific types
   05210 Colorectal cancer
    126961422
   05212 Pancreatic cancer
    126961422
   05225 Hepatocellular carcinoma
    126961422
   05226 Gastric cancer
    126961422
   05214 Glioma
    126961422
   05221 Acute myeloid leukemia
    126961422
   05220 Chronic myeloid leukemia
    126961422
   05218 Melanoma
    126961422
   05211 Renal cell carcinoma
    126961422
   05215 Prostate cancer
    126961422
   05213 Endometrial cancer
    126961422
   05224 Breast cancer
    126961422
   05222 Small cell lung cancer
    126961422
   05223 Non-small cell lung cancer
    126961422
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    126961422
   05170 Human immunodeficiency virus 1 infection
    126961422
   05161 Hepatitis B
    126961422
   05160 Hepatitis C
    126961422
   05171 Coronavirus disease - COVID-19
    126961422
   05164 Influenza A
    126961422
   05162 Measles
    126961422
   05168 Herpes simplex virus 1 infection
    126961422
   05163 Human cytomegalovirus infection
    126961422
   05167 Kaposi sarcoma-associated herpesvirus infection
    126961422
   05169 Epstein-Barr virus infection
    126961422
   05165 Human papillomavirus infection
    126961422
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    126961422
   05100 Bacterial invasion of epithelial cells
    126961422
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    126961422
   05142 Chagas disease
    126961422
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    126961422
   05017 Spinocerebellar ataxia
    126961422
   05020 Prion disease
    126961422
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    126961422
   05418 Fluid shear stress and atherosclerosis
    126961422
   05415 Diabetic cardiomyopathy
    126961422
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    126961422
   04932 Non-alcoholic fatty liver disease
    126961422
   04931 Insulin resistance
    126961422
   04933 AGE-RAGE signaling pathway in diabetic complications
    126961422
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    126961422
   01524 Platinum drug resistance
    126961422
   01522 Endocrine resistance
    126961422
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mthb04131]
    126961422
Membrane trafficking [BR:mthb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    126961422
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 SH2_1 Transcrip_act Exonuc_VII_L
Other DBs
NCBI-GeneID: 126961422
NCBI-ProteinID: XP_050657766
LinkDB
Position
1:complement(45276830..45397668)
AA seq 478 aa
MPAFTPPGAVGWRLSGAMYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPK
PMTSAVTNGMKDSSVSLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLT
LRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRY
QQDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETI
KIFEEQCHTQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKK
QALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADENYFI
NEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKH
CVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgcctgcttttacccctccaggcgcggttgggtggcgcctcagcggcgcgatgtacaat
acggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatgccctattcg
acagaactgatattttatattgaaatggatcctccagctcttccaccaaagccacctaag
ccaatgacttcagcagttacaaatggaatgaaggacagttctgtttctcttcaggatgca
gaatggtactggggggatatttcaagggaggaggtaaatgacaaattgcgggatatgcca
gatgggaccttcttggtccgagatgcctcaacaaaaatgcagggagattatactttgact
ttgcggaagggaggcaataataagttaataaagatctatcaccgggatggtaaatatggc
ttttctgatcctctgacatttaattccgtggtggagctcattaaccactatcaccatgaa
tctcttgctcagtacaatcccaagcttgatgtgaagctgatgtacccagtgtccagatac
caacaggatcagttggtaaaagaagataatattgatgcagtaggtaaaaaactgcaagaa
taccactctcagtatcaagagaagagtaaagagtatgataggctctatgaagaatatacg
agaacatcccaggaaatacagatgaagaggactgcaatagaagcttttaatgaaacaatt
aaaatatttgaagagcagtgtcacacacaagaacaacatagcaaagagtatattgagcga
tttcgcagagaggggaatgaaaaggagattgaacgaattatgatgaattatgataaattg
aaatcacgtctgggagagattcatgatagcaaaatgcgtctagagcaggatttgaagaaa
caagctttggacaaccgagaaatagataaaaaaatgaatagtatcaaacctgacctgatc
cagctgcgaaagatccgagatcagcaccttgtatggctcaatcacaaaggggtgagacag
aaacgcctgaatgcctggctgggaattaagaatgaggatgctgatgagaactattttatc
aatgaggaagatgaaaacctgccccactatgatgagaaaacctggtttgttgaggatatc
aatcgagtacaagcagaggacttgctttatgggaaacctgatggtgcattcttaattcgt
gagagtagcaagaaaggatgctatgcttgctctgtggtggctgatggggaagtgaagcac
tgtgtgatctacagcactgctcggggctatggctttgcagagccctacaacctgtacagc
tctctgaaggagctagtgctccattaccagcagacatccttggttcagcacaacgactcc
ctcaatgtcaggcttgcctaccctgttcatgcacagatgccctcgctgtgcagataa

DBGET integrated database retrieval system