Moorella thermoacetica DSM 521: MOTHE_c03410 Help Entry MOTHE_c03410      CDS       T06431                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mtho  Moorella thermoacetica DSM 521 Pathway mtho00790   Folate biosynthesis mtho01100   Metabolic pathways mtho01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:mtho00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     MOTHE_c03410 (folB) Enzymes [BR:mtho01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      MOTHE_c03410 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      MOTHE_c03410 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      MOTHE_c03410 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AKX93155 UniProt:  A0A1D7X7C1 LinkDB All DBs Position complement(326857..327225) Genome browser AA seq 122 aa AA seqDB search MGQDKIILAGLEFYGFHGNHPAEQQLGQPFIVDLELYLDLEPAGRTDALEATVNYGQVYR LVQEIVTGRPYKLLEALAAAISDGILAGFPVDEVLVRVKKPRAPLPGSFDYAAVEIRRRR KE NT seq 369 nt NT seq  +upstreamnt  +downstreamnt ttgggtcaggataagattattttagccgggctggagttttatggcttccacggcaaccat ccggcagagcagcagttggggcagccctttattgtcgacctcgaactctacctggacctg gaacctgccgggaggaccgatgctctggaagccaccgtcaactacggccaggtctaccgc ctggtgcaggaaatagtcaccggccgcccctataaactcctggaggccctggccgcggcc atcagcgacggcattctggccggtttcccggtggacgaggtcctggtgcgtgtaaaaaaa ccccgggcaccactgcccgggagctttgactacgccgccgttgagatccggcgccggaga aaagaatag

DBGET integrated database retrieval system