Medicago truncatula (barrel medic): 112421021 Help Entry 112421021         CDS       T01716                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism mtr  Medicago truncatula (barrel medic) Pathway mtr00510   N-Glycan biosynthesis mtr00513   Various types of N-glycan biosynthesis mtr04141   Protein processing in endoplasmic reticulum Module mtr_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:mtr00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     112421021    00513 Various types of N-glycan biosynthesis     112421021  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112421021 SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  112421021 NCBI-ProteinID:  XP_024636713 LinkDB All DBs Position 4:60660715..60664387 Genome browser AA seq 76 aa AA seqDB search MAPKAIASPIPDSLYPTLSVFTLAIGLILTASFFIYEATSSRKTRNLAQELTTGAIASVF LGFGSLFLLLACGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctccaaaagcgatcgcgagtcctattcctgattcgttatacccgacactctccgtc ttcacactcgcaatcggcctcattttaactgcttctttcttcatttatgaagcaacctct tctaggaaaacccgtaaccttgctcaggagctgacaacgggagcaattgcatcagttttc ttgggttttgggtcgttgttcctcctacttgcctgcggtgtgtatgtctaa

DBGET integrated database retrieval system