Medicago truncatula (barrel medic): 11413962 Help Entry 11413962          CDS       T01716                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism mtr  Medicago truncatula (barrel medic) Pathway mtr03420   Nucleotide excision repair mtr04120   Ubiquitin mediated proteolysis mtr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     11413962    04120 Ubiquitin mediated proteolysis     11413962   09124 Replication and repair    03420 Nucleotide excision repair     11413962  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mtr04121]     11413962    03400 DNA repair and recombination proteins [BR:mtr03400]     11413962 Enzymes [BR:mtr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      11413962 Ubiquitin system [BR:mtr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    11413962   Multi subunit type E3    SCF complex     Ring finger protein      11413962    Cul2 complex      11413962    Cul3 complex      11413962    Cul4 complex      11413962    Cul7 complex      11413962    Cul8 complex      11413962    Cul9 complex      11413962 DNA repair and recombination proteins [BR:mtr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       11413962     TCR (transcription coupled repair) factors      Cul4-CSA complex       11413962 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-RING_11 zf-C3HC4 DUF8003 Motif Other DBs NCBI-GeneID:  11413962 NCBI-ProteinID:  XP_003597006 UniProt:  G7IKI7 LinkDB All DBs Position 2:43441220..43444934 Genome browser AA seq 118 aa AA seqDB search MATLDSDVPMVPAGETSCCAHGGPSSKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcgacacttgattccgacgttccaatggttcccgccggcgaaacttcctgctgcgct cacggcggtccttcttccaagaagccgaagcgcttcgagatcaagaaatggaatgctgtt tctctctgggcttgggatattgttgttgataattgtgctatctgtaggaatcatatcatg gatctctgtattgagtgtcaggcgaatcaggctagcgccacgagcgaggaatgcacagtt gcttggggggtttgtaaccatgcttttcacttccattgcataagcaggtggctgaaaacc cgtcaagtttgtcctctagacaacagtgagtgggaatttcagaaatacggccactag

DBGET integrated database retrieval system