Medicago truncatula (barrel medic): 25492127 Help Entry 25492127          CDS       T01716                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism mtr  Medicago truncatula (barrel medic) Pathway mtr03420   Nucleotide excision repair mtr04120   Ubiquitin mediated proteolysis mtr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     25492127    04120 Ubiquitin mediated proteolysis     25492127   09124 Replication and repair    03420 Nucleotide excision repair     25492127  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mtr04121]     25492127    03400 DNA repair and recombination proteins [BR:mtr03400]     25492127 Enzymes [BR:mtr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      25492127 Ubiquitin system [BR:mtr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    25492127   Multi subunit type E3    SCF complex     Ring finger protein      25492127    Cul2 complex      25492127    Cul3 complex      25492127    Cul4 complex      25492127    Cul7 complex      25492127    Cul8 complex      25492127    Cul9 complex      25492127 DNA repair and recombination proteins [BR:mtr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       25492127     TCR (transcription coupled repair) factors      Cul4-CSA complex       25492127 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  25492127 NCBI-ProteinID:  XP_013455640 UniProt:  I3T5Z4 LinkDB All DBs Position 4:complement(24971481..24975926) Genome browser AA seq 117 aa AA seqDB search MSTLDSDVTMVPAGEPSSSAAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtcgacactcgattccgacgtaaccatggttcccgccggcgaaccttcaagcagcgcc gccggtccatcttccaagaaacccaaacgcttcgagattaagaagtggaacgccgttgct ctctgggcttgggatatcgttgttgataactgtgctatttgccgtaaccatatcatggat ctctgtattgagtgccaagctaatcaggctagtgctactagcgaggaatgcactgttgct tggggggtttgtaaccatgcttttcacttccattgcattagtagatggctcaagactcgt caagtgtgtcctcttgacaacagtgagtgggagtttcagaaatacggccactag

DBGET integrated database retrieval system