KEGG   Microbacterium testaceum: MTES_3604
Entry
MTES_3604         CDS       T01423                                 
Name
(GenBank) peptide arylation enzyme
  KO
K20423  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase [EC:6.2.1.43]
Organism
mts  Microbacterium testaceum
Pathway
mts01100  Metabolic pathways
mts01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mts00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    MTES_3604
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:mts01008]
    MTES_3604
Enzymes [BR:mts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.43  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase
     MTES_3604
Polyketide biosynthesis proteins [BR:mts01008]
 Polyketide tailoring proteins
  Others
   MTES_3604
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: BAJ76568
UniProt: E8NG97
LinkDB
Position
3906494..3908173
AA seq 559 aa
MKTREGTTPWPTEVADRYRAEGLWQGRTLGDAFAAAASRHPERIALVNGDLSLTYAEVHD
RVEACAARLIERGLAPDDRVVVQLPNHWTFVVLTLACLRVGVVPVMALPAHREHELRHLI
SASEAVALVTPDTLRDFDHLALARALRASSPTVREVIVLGDVTDQPDTVSLTALCAPSDD
ATRGRTLPTPDAADVAVFLLSGGTTGLPKLIARTHDDYLCNILLTSPPAAVDRDTVYLAT
LPMGHNFPLACPGILGTLLAGGTVVPLGSPRPERAFAAIERYGVTHTAAVPAVVASWLDH
AGAVGFDALRSLRVLQVGGARLADELAERVVRGLPGTLQQVFGMAEGLINVTRLDDPVEV
VVGTQGRPVSPFDEVRVVDETTGREVAPGEPGVLLTRGPYTPRGYYDAPEANARSFTPDG
FYITGDIVRQRPDGNLVVEGRSKDMINRGGENISAEEVENLVYGLAAVRLAAAVAMPHDT
LGETVCLFAVLHDGHALDLGSVRAHFDRAGVAAFKRPDHLVTVDELPLTKVGKIDKKALR
ERLAAERTTELAASDGLVR
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgaagacacgcgaggggacgacgccctggccgaccgaggtcgccgaccgctaccgcgcc
gaagggctgtggcagggtcgcacgctcggcgacgcgttcgccgcggccgcttcccggcat
cctgaacgcatcgccctggtcaacggcgacctgtccctcacctacgccgaggtgcacgac
cgggtcgaggcgtgcgccgcgcgcctgatcgagcggggcctcgcccccgacgaccgcgtg
gtcgtgcaactgccgaaccactggacgttcgtcgtgctgacgctggcgtgcctgcgggtc
ggggtcgtgcccgtcatggcgctgccggcccaccgtgagcacgaactacggcacttgatc
tcggcatccgaagccgtcgccctggtcactcccgacaccctgcgcgacttcgatcacctg
gccctcgcccgcgcgctgcgcgcgtcgagcccgacggtgcgggaggtcatcgtcctgggt
gacgtcaccgaccagcccgacaccgtgagcctcaccgccctgtgcgcgccgtccgacgat
gccacccgcggccggacgcttccgactccggatgccgccgacgtcgccgtgttcctcctg
tcgggcggcacgacgggcctgccgaaactcatcgcccgcacgcacgacgactacctctgc
aacatcctgctgacctctccgcccgcggcggtcgaccgcgacaccgtgtatctggcgacc
ctgccgatgggacacaactttccactcgcgtgtcccggcatcctgggcaccctcctcgcc
ggcggcaccgtcgtccctctcggctccccccgacccgaacgcgccttcgcggcgatcgaa
cggtacggcgtgacccataccgccgcggtgcccgctgtcgtcgcctcgtggctcgatcac
gccggtgccgtcgggttcgatgcgctccggagcctgcgcgtgctgcaggtgggcggggcg
cggctggccgatgaactggccgaacgtgtcgtgcgcgggctcccgggaacgctgcagcag
gtgttcggcatggccgagggactcatcaacgtcacgcgcctcgacgacccggtcgaggtc
gtcgtcggcacgcagggtcggcccgtgtcgcccttcgacgaggtgcgcgtggtcgatgag
acgaccggccgagaggtcgctccgggcgagcccggcgtgctgctgacgcgcggtccgtac
acgccgcgggggtactacgacgcccccgaggccaacgcgcgatccttcacccccgacggc
ttctacatcaccggagacatcgtgcgccagcgccccgacggcaatctcgtcgtcgaggga
cgcagcaaagacatgatcaaccgcgggggtgagaacatctccgccgaagaggtcgagaac
ctcgtgtacggactcgcggcggtgcgtctggcggccgcggtggccatgccgcacgacacc
ctcggcgagacggtgtgcctgttcgcggtgctgcacgacgggcacgctctcgacctcggc
tcggtgcgcgcacacttcgaccgcgcgggagttgcggcgttcaagcgtcccgaccacctc
gtcacggtcgatgagctgcccctgacgaaggtcggcaagatcgacaagaaggcgctgagg
gagcggctcgccgccgaacgcacgaccgaactcgcggcatccgacgggctcgttcgatga

DBGET integrated database retrieval system