Mesitornis unicolor (brown roatelo): 104535351 Help Entry 104535351         CDS       T08455                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism mui  Mesitornis unicolor (brown roatelo) Pathway mui04060   Cytokine-cytokine receptor interaction mui04068   FoxO signaling pathway mui04218   Cellular senescence mui04620   Toll-like receptor signaling pathway mui04621   NOD-like receptor signaling pathway mui04623   Cytosolic DNA-sensing pathway mui04625   C-type lectin receptor signaling pathway mui04672   Intestinal immune network for IgA production mui05132   Salmonella infection mui05164   Influenza A mui05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:mui00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     104535351 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104535351 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104535351 (IL6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104535351 (IL6)    04621 NOD-like receptor signaling pathway     104535351 (IL6)    04623 Cytosolic DNA-sensing pathway     104535351 (IL6)    04625 C-type lectin receptor signaling pathway     104535351 (IL6)    04672 Intestinal immune network for IgA production     104535351 (IL6)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104535351 (IL6)    05168 Herpes simplex virus 1 infection     104535351 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     104535351 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mui04052]     104535351 (IL6) Cytokines and neuropeptides [BR:mui04052]  Cytokines   Interleukins    104535351 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 PGC7_Stella IL23 Motif Other DBs NCBI-GeneID:  104535351 NCBI-ProteinID:  XP_010191579 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MCEKFTVCKNSVEMLALNNLNLPKLTKEDGCLFDGFDEDKCLRKISSGLYTFRTYLEYVK DTFTSERQNVESLCYSTEHLAHTLRQMVINPNEVIIPDPAAQKSLRARLRSDKTWIEKIT THLILRDFTSFMEKTVRAVRYLKNTRSFSV NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgtgcgagaagtttaccgtctgcaagaacagcgtggaaatgcttgccctgaacaacctc aacctccccaagttgaccaaagaagatgggtgtctgttcgatggcttcgatgaggataaa tgcttgaggaaaatctccagcgggctttacacatttcggacataccttgaatacgtcaaa gacacttttaccagtgaaaggcaaaatgttgaatcattgtgttacagcacagagcacctg gcacataccttaagacagatggtgatcaatcccaatgaagtgatcatcccagacccagct gcccagaaatccctccgcgcaaggctgaggtctgataagacctggatcgagaaaatcacc acccacctcatcctccgagactttacttcatttatggagaaaaccgtgagggccgttcgc tatttgaaaaacaccaggagtttcagtgtctga

DBGET integrated database retrieval system