Mesitornis unicolor (brown roatelo): 104537576 Help Entry 104537576         CDS       T08455                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism mui  Mesitornis unicolor (brown roatelo) Pathway mui04010   MAPK signaling pathway mui04510   Focal adhesion mui04517   IgSF CAM signaling mui04520   Adherens junction Brite KEGG Orthology (KO) [BR:mui00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104537576 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     104537576 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     104537576 (RAP1B)    04520 Adherens junction     104537576 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mui04147]     104537576 (RAP1B)    04031 GTP-binding proteins [BR:mui04031]     104537576 (RAP1B) Exosome [BR:mui04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104537576 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    104537576 (RAP1B)   Exosomal proteins of colorectal cancer cells    104537576 (RAP1B) GTP-binding proteins [BR:mui04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     104537576 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  104537576 NCBI-ProteinID:  XP_010178808 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPM ILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPV PGKARKKSSCQLL NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgcttgaaatcttagatactgcaggaacggaacagtttacagcaatgagagacctatac atgaaaaatggtcaaggttttgcattagtatactccatcacagcacagtccacatttaat gatttacaggacctaagagaacaaattcttcgagtcaaagacactgatgatgtgcctatg attctggttggcaataagtgtgacttggaagatgaaagagttgtgggaaaggagcaaggt cagaacttagcaaggcaatggaataactgtgcattcttagagtcttctgcaaaatcaaag ataaatgttaacgagatcttttatgaccttgtgcgacaaattaacagaaaaactccagtg cctggaaaagcacgtaaaaagtcatcatgtcagctactttaa

DBGET integrated database retrieval system